4KTW


Conserved Protein Domain Family
DUF3882

?
pfam07066: DUF3882 
Click on image for an interactive view with Cn3D
Lactococcus phage M3 protein
This family consists of several Lactococcus phage middle-3 (M3) proteins of around 160 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 369194
View PSSM: pfam07066
Aligned: 3 rows
Threshold Bit Score: 264.151
Threshold Setting Gi: 75095727
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4KTW_A     1 MKKILAINFSTASkkgegTGYAFRK--DGQVYVGSIkAYNPKKTAWERTFDIVNAIKDIIDEFDLKGYHLAIETPIMGRN 78 
O21920     1 MSKALAIDFSTSN-----TGYAFRNplTNEYVVGSI-AGGKSKDPLERAKLIADGITEVIEHYNLFDYFIYIEEPIITFK 74  Lactococcus virus sk1
ANM46918   1 MKKILAIDFSTASkkgegTGYAFRK--DGQVYVGSIkAYNPKKTAWERTFDIVNAIKDIIDEFDLKGYHLAIETPIMGRN 78  Lactococcus phage M...
4KTW_A    79 RKHSITLANCNGYFIGAIDGLVN-GYTFIDNSKWCSYHLISGKREQRKEESLELLKATGLVDSNCKDDNIADAYNILTYC 157
O21920    75 SKGNISLIRANGSFLGVMRNRHNiGYVDVPNSKWCGYHLIKGKSALRKVQSIEILKSYNIVPDNDINDDMADAFCILLYV 154 Lactococcus virus sk1
ANM46918  79 RKHSITLANCNGYFIGAIDGLVN-GYTFIDNSKWCSYHLISGKREQRKEESLELLKATGLVDSNCKDDNIADAYNILTYC 157 Lactococcus phage M...
4KTW_A   158 EH 159
O21920   155 ES 156 Lactococcus virus sk1
ANM46918 158 EH 159 Lactococcus phage M6653
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap