3VIR


Conserved Protein Domain Family
Swi5

?
pfam07061: Swi5 
Click on image for an interactive view with Cn3D
Swi5
Swi5 is involved in meiotic DNA repair synthesis and meiotic joint molecule formation. It is known to interact with Swi2, Rhp51 and Swi6.
Statistics
?
PSSM-Id: 399800
View PSSM: pfam07061
Aligned: 60 rows
Threshold Bit Score: 57.1813
Threshold Setting Gi: 146142767
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3VIR_A        16 QKEQLESSLQDALAKLKNrdAKQTVQKHIDLLHTYNEIRDIALGMIGKVAEHEKCTSVELFDRFGVNGS 84  Schizosaccharomyces pombe ...
A9UL70        39 KEAALDQEIAQLESEGF---SMAELEEHITLLHEYNELKDVGQMLLGRLAVLRGVTTKELYAEFGMNLE 104 tropical clawed frog
XP_012433702 162 KDLALDQEIAQLLSEGY---SLEELDKHISLLHEYNEIKDAGQMLLGKLAVIRGVTTKQLYPEYDLELS 227 zebra finch
XP_007475133  67 KRDALDQEISQLVAEGY---VVSELEDHISLLHEYNDIKDVGQMLMGKLASIRGVTTKELYPEFDLDVN 132 gray short-tailed opossum
Q63ZV7        23 KQDMLDKEISQLIAEGY---RVIELEQHISLLHEYNDIKDVSQMLLGKLAVTRGVTTKELYPDFDLNPN 88  Norway rat
XP_005321230 119 KKRMLEREISQLISGGY---SEDEMEEHISLLHEYNDIKDVGQMLLGKLAVIRGVTSKELYPEFGLDVN 184 thirteen-lined ground squi...
PNI69070     169 KRDMLDKEISQFVSEGY---SVDELEDHITQLHEYNDIKDVGQMLMGKLAVIRGVTTKELYPEFGLDMN 234 chimpanzee
EFA81742      58 QEKKLNDKLKPYLDELAK--LKEESKKNIDKLHVYNEIKESCQMMFGKIAILDGKTIKQVYKEFDMELE 124 Heterostelium album PN500
EGC35735      53 QERALNDQLEPYRAQMKQ--LDDDAKRNLDKVHQYNEIKDSCQAIIGKLAELEGLTIAQMNKKLGIDEN 119 Dictyostelium purpureum
Q54BH2        53 EENQILKDLEPFKKQIKE--LEEIEKRNLDKVHTYNEIKDATQNQIGKLAEYEGVTIIQMTKKLGIfln 119 Dictyostelium discoideum AX4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap