Conserved Protein Domain Family
MAP70

?
pfam07058: MAP70 
Microtubule-associated protein 70
This family represents a family of plant microtubule-associated proteins of size 70 kDa. The proteins contain four predicted coiled-coil domains, and truncation studies identify a central domain that targets the proteins to microtubules. It has no predicted trans-membrane domains, and the region between the coils from approximately residues 240-483 is the targetting region.
Statistics
?
PSSM-Id: 399798
View PSSM: pfam07058
Aligned: 11 rows
Threshold Bit Score: 583.315
Threshold Setting Gi: 225469059
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006856278  16 SSDPIVLELNRLENHLKDNDRELGIAHAEIKALKVTERLKEKAVEELNDDLKKLDEKLRFTENLLEDKNLEIKKLVSERR 95  Amborella trich...
ERM98119      50 GSDPVKVELNRLENEVKDKDRELGEAQAEIKALKLSERLREKAVEELTDELQKVDEKLKAAGALIESKNLEIKKINDEKK 129 Amborella trich...
XP_003553384  34 GSDPVRVELTRLQNELREKDRELGDALAEIKSLRNSERLKEKGVEELTDELIKVDEKLKAAEALLESKNLEIKKINEEKR 113 soybean
CBI30130      53 GSDPVRVELNRLENEVRDKDRELGDAHAEIKALKYSERLKEKAVEELTDELQKVDGKLKATEALLESKNLEIKKINDERK 132 wine grape
XP_002267938  19 HSDPIVLEFNRLQNQLKEKDRELGVASSEIKALRATIVLKDKALEQFRNEVNKLDERLGVIENLLKQKDLEIKKLTSEKK 98  wine grape
XP_002980874  32 GSDPIKVELNRLENEVRDKDRELCEAHAEIKALRQTERLKEKAVEELFDEREKLQEKLKAMEIALENKNLDLKRTNDERK 111 Selaginella moe...
ERN02085      63 GSDPVKIELNRLQNEVIDKNRELVDAQAEIKALKLTDRIKEKALEELTEELRKMVEKFQASEAALENKNLEIKRVVDEKK 142 Amborella trich...
XP_009404137  67 GSDPVRVELCRLENEVRDRDRELSEAQAEIKALRLSERAREKAVEELTEEVNKMDEKLKLTESLLENRNLEIKKINDEKK 146 wild Malaysian ...
EEE65458       9 VELTRLENELRDKERELGEAQTEIRALRLSERAREKAVEELTDELEKMFEKLKLTESLLDSKNLEVKKINDEKKAAMAAQ 88  Japanese rice
Q9ZUA3        71 GSDPVKVELNRLENDVRDKDRELSESQAEIKALRLSERQREKAVEELTEELGKMSEKLKLTENLLDSKNLEIKKINEEKR 150 thale cress
EEF36422      67 GSDPVKVELNRLENEVRDKDRELGEAQAEIKALRLSERLREKAVEELTDELSKVEEKLKLTESLLESKNLEIKKINDEKK 146 castor bean
XP_006856278  96 DALAAQFAAEATLRRVHANQKDEDYIPLDAVLAPMESEIRMCRNEISvlqedkkalERLTKSKELALLETERMLKIAIER 175 Amborella trich...
ERM98119     130 ASLAAQYAAEATLRRVHAAQKDDEMPPIEAIIAPLEAELRLARLEGA---------GSPYQVKGAALLEAERTVQVALAK 200 Amborella trich...
XP_003553384 114 AALAAQFAAEATLRRVHAAQKDDEMPPIEAIIAPLEAELKLARMEVAklqddnralGRLTKSKEAALLEAERTVQIALAK 193 soybean
CBI30130     133 AALAAQFAAEATLRRVHAAQKDDEMPPIEAIIAPLEAELKLARLEAAklqddnralDRLTKSKETALLEAERTVEIALAK 212 wine grape
XP_002267938  99 DALAAQFAAEAALRRVHANQKDDDTVPIEDVIAPLEADIKMYKIEIGrlqednkalERHIKSKESALLEAERILRSALER 178 wine grape
XP_002980874 112 SALAAQAAAEATLRRLHASQKDEDLLPLEAILAPVEAELKSTRNDFLklqddnkalDRLTKSKEAALLEAERAVQIAEAK 191 Selaginella moe...
ERN02085     143 AALAAQFAAEATLRRVHAAQKDEELPPLEAILSPLEAEIKQLRQEVSklqddnralERLTKSKEAALLEAERDVQSAYFK 222 Amborella trich...
XP_009404137 147 AALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEAELKLARQEIAklqddnralDRLTKSKEAALLEAERTVQIALAK 226 wild Malaysian ...
EEE65458      89 FAAEATLRRVHAAQKDDDMPPIEAILAPLEAELKLARQEIAKLQDDNraldrltkqKEAALLDAERTVEIAMAKAAMVDD 168 Japanese rice
Q9ZUA3       151 ASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEAELKLARHEIVklqddnralDRLTKSKEAALLDAERTVQSALAK 230 thale cress
EEF36422     147 ASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEAELKLARQEIAklqddnkalDRLTKSKEAALLEAERTVQVALAK 226 castor bean
XP_006856278 176 ALLVEDLQNQNLELKRQIDICQEENRILDKANRQKVAEVEKLSQTIHELEESILAGGAAANAVRDYQRQILEMNEERRTL 255 Amborella trich...
ERM98119     201 AALVDDLQNKNQELMKQIEICQEENKILDKLHRQKVAEVEKLSQTVRELEEAVLAGGAAANAVRDYQRKFMEMNEEKKIL 280 Amborella trich...
XP_003553384 194 ASLVDDLQNKNQELMKQIEICQEENKILDKMLRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNDERKIL 273 soybean
CBI30130     213 ASLVDDLQNKNQELMKQIEICQEENKILDKMHRQKVAEVKKLTQTVCELEEAVLAGGAAANAVRDYRRKVQEMNDERKIL 292 wine grape
XP_002267938 179 ALIVEEVQNQNFELKRQIEICQEENKILDKTNRQKVLEVEKLSQTIQELEEAILAGGVAANAIRDYRRQISELNEEKRTL 258 wine grape
XP_002980874 192 ASLVDDLQNRNQELLKQIEICQEENKILDKMHRQKVAEVEKLSTTVAELEEALLAGGAAANAARDFERQVHHLMEEKRTL 271 Selaginella moe...
ERN02085     223 ASLVDELQNRNQELMKQIEISLEENKILDKINRQKIAEVEKLGQTVRDLEEALLSGAAAANAVRDYQRQVSELKGEKRTL 302 Amborella trich...
XP_009404137 227 ASMVDDLQNKNQELMKQIEICQEENKILDKMHRQKVAEVEKLSQTVRELEEAVLAGGAAANAVRDYQRKVQEMNDEMKTL 306 wild Malaysian ...
EEE65458     169 LQNKNQELMKQIEICHEENKILDKLQRQKVAEVKKLSLTVKELEEAVLRGGATANVVRDYQRQVQEVNDQKKTLECELAR 248 Japanese rice
Q9ZUA3       231 ASMVDDLQNKNQELMKQIEICQEENRILDKLHRQKVAEVEKFTQTVRELEEAVLAGGTAANAVRDYQRKFQEMNEERRIL 310 thale cress
EEF36422     227 ASMVDDLQNKNQELMKQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEERKTL 306 castor bean
XP_006856278 256 ERELARVKILANRVATVVANEWKDDNDKVMPVKQWLEERKVLQGEIQRLRDKLNVSERTAKAESQLKDKFKLRLKTLEEG 335 Amborella trich...
ERM98119     281 DRELARTKVTANRVAVVVANEWKDANDKVMPVRQWLEERRFLQGEMQQLRDKLAIAERTAKSEAQLKERYHLRLKVLEDG 360 Amborella trich...
XP_003553384 274 EREVARAKVTANRVATVVANEWKDANDKVMPVKQWLEERKFFQGEMQQLRDKLAIAERTAKAEAQMKEKYQLRFKVLEER 353 soybean
CBI30130     293 DRELSRAKVTANRVAVVVANEWKDANDKVMPVKQWLEERKFFQGEMQLLRDKLAVAERTAKAEAQLKEKYQLRFKVLEER 372 wine grape
XP_002267938 259 ERELARVKVSANRVATVVANEWKDENDKVMPIKQWLEERRLLQAETQRLRDKLAISERTAKAEAQLKDKLKLRLKTLEEG 338 wine grape
XP_002980874 272 ERELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFMQGEMQQLRDKLATTERTARSEAQLKEKLQVRLKVLEEG 351 Selaginella moe...
ERN02085     303 ERTLSRAKVVENRVAVVVANEWKDSDGKVMPVKQWLEERRFLMGEMQQLRDKLSIAERTAKTEAQLKEKFQLRLKVVEDG 382 Amborella trich...
XP_009404137 307 DRELSRAKVSANRVAVVVANEWKDSNDKVMPVKQWLEERRFMQGEMQQLRDKLVIAERTARSEAQLKEKFQLRLKVLEDG 386 wild Malaysian ...
EEE65458     249 AKVTANRVAVVVANEWKDSNDKVMPVKQWLEERRFLQGEMQQLRDKLAVAERTARSEAQLKEKYQLRLKVLEDGLRGPPS 328 Japanese rice
Q9ZUA3       311 DRELARAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAIADRAAKSEAQLKEKFQLRLRVLEES 390 thale cress
EEF36422     307 DRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAITERAAKSEAQLKEKYHLRLKVLEES 386 castor bean
XP_006856278 336 LKQVTTSSPNteGSHLK-QTVKPEp---VLG------YLSSNMgPRKRSQSQPRASFNAEqstvqQrpnvtsensnsnrt 405 Amborella trich...
ERM98119     361 LKASPSGHIR--PSEVRsVSNGRSrr-qSLGgaenfsRLSSNG-LSRRTPASSPSNNIST-----V-------------- 417 Amborella trich...
XP_003553384 354 VKTSNGNSKFt-VSDGRnIATGPSrr-qSFGgaeslsASSSNGyQSRKTSISRPGSLRSNsa-nvL-------------- 416 soybean
CBI30130     373 LRASPSGNLRt-TSEGRsISNGPSrr-qSLGgaenlsRSASNGfALRRTANSQSGSIRSNsa-svL-------------- 435 wine grape
XP_002267938 339 LKQVSSFSe---NPYLScRSPKPEksnhILG------FLSGNGgLKRRSTSQPRGSCIGKts-plMppnvengaadaage 408 wine grape
XP_002980874 352 LRTSTNGSTRkhDDFLRsGTNGASvrrqSTGgs-----dIGNGvARRRPSMSSASQMRGSvsgstI-------------- 412 Selaginella moe...
ERN02085     383 LRSSFNGGVR--SSELQnCSNGVSrr-lSLGgfenstKLSSNSfGTKKVPSLTRSSTMSStsssaL-------------- 445 Amborella trich...
XP_009404137 387 SRMSASGTYRt-TIEGKsVSNGPSrr-qSLGgadnvpK-SVNGfLSKR-PSFQMRSSVSSs---tV-------------- 445 wild Malaysian ...
EEE65458     329 GSSRLPTEGKs-FSNGPsRRLSLGga-dNMSklspngLLARRSpSFHSRSSLSSSSSLVLkh-akG-------------- 391 Japanese rice
Q9ZUA3       391 LRGPSSSGNRs-TPEGRsMSNGPSrr-qSLGgadiipKLTSNGfFSKRSPSSQFRSLNASts--tI-------------- 452 thale cress
EEF36422     387 LRGSSSNT-Rs-MPEGRsTSNGPSrr-qSLGgadnfsKFTSNGfLSKRTPTSQLRSSLSSn---sV-------------- 446 castor bean
XP_006856278 406 LEHVNSLKYKYISGKnl-vkKNLwaPR-NKLVDDVGKENSERKE--DVGleefasvGPEVSKDFSAEAhsmQSTPEKDDL 481 Amborella trich...
ERM98119     418 LKHAKGSSRSFDGGN-----RLS--EKnKVCLNNGVVPNSSLNTavEEH-------RRTENSNTCKEN---QDVKQSDTS 480 Amborella trich...
XP_003553384 417 LKHAKLSSRSFDGGS-----RNL--ER-ERPTSDANGLDNMPRNsnIQT-------ITSETITTHEES---ANGTPVKKS 478 soybean
CBI30130     436 LRNAKISSRSFDGGS-----RSL--DR-DKVIPNAARKHEVLTDtnDQI-------QNAKTIGTHEAS---TNGNRSEKT 497 wine grape
XP_002267938 409 LKGVNSLKKKYASGEnm-lrKSLwaSR-SKVADIGGKENTEMKSntDMHidk-fnnDTAVSADAKIKGgakEETQNVGSA 485 wine grape
XP_002980874 413 LKNGKFGSKAFDGS------KSLdaGR-FKAYANGCEEPRKVSSaaSGA-------GGGGGGGGGGGDvkpEAGKVEGAT 478 Selaginella moe...
ERN02085     446 LKHAKGASKSFDGSKsssegQSI--DG-NKSFSNGLD-DPCFGNntDES-------SMNTINNSGREI---CCNKQSEFA 511 Amborella trich...
XP_009404137 446 LKHAKGASKSFDGGT-----RSL--DR-SKVLLTGAG--LSLNRssDAT-------GDGVTHESWKKI---PDEKTNDFP 505 wild Malaysian ...
EEE65458     392 TSKSFDGGTRSLDRS-----KIN--GN-GAHLLNRST---DAVRdcETN-------DSWKGNADEGTI---ENTNSNTDE 450 Japanese rice
Q9ZUA3       453 LKHAKGTSRSFDGGS-----RSL--DR-SKVLTNEPRSKFPLNQssEGT-------SGGGSPNSTKQG-------DSEKA 510 thale cress
EEF36422     447 LKHAKGTSKSFDGGT-----RSL--DRgSRALLNGSSPNCSFNQpcDET-------KDTEAANMWKGN---SDEKPVEFP 509 castor bean
XP_006856278 482 NVDCEDI------------VSGFLYDKLQKEVLNLRKSSQEKDGLLTAKDEEIKMLVKKIDTLTKAMETELKKMRRESAS 549 Amborella trich...
ERM98119     481 KADADDY------------VSGLLYDMLQKEVIALRKASHEKDQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAT 548 Amborella trich...
XP_003553384 479 KSENEDY------------VSGMLYDMLQKEVISLRKACHEKDLTLKDKDDAIEMLAKKVDTLSKAMEVEARKMRREVAS 546 soybean
CBI30130     498 KSELDDS------------VSGVLYDMLQKEVITLRRACHEKDQSLKDKDDAIEMLAKKVDTLNKAMGVEAKKMRREVAA 565 wine grape
XP_002267938 486 GFDSEDM------------VSAFLYDRLQREVINLRKSCEVKNNTLTAKDDEIKMLMRKVDALSKAIEVESKKIKREAAA 553 wine grape
XP_002980874 479 VAAADDN------------VSVLFYDMLQKEVVTLRKLGHEKDQSLKDKDDAIEMLSKKVDTLTKAMEVEAKKMRREVAA 546 Selaginella moe...
ERN02085     512 EPTSTDL------------VSGILYDMLQKEVIVLRKASHEKDQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAA 579 Amborella trich...
XP_009404137 506 NVDSDDC------------VSGLLYDMLQKEVITLRKACHEKDQSLKDKDDAIEMLAKKVDMLTKAMEVEAKKMRREVAA 573 wild Malaysian ...
EEE65458     451 SNKETANnksaemvsgflyDMLQKEVISLRKACHEKDQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVA 530 Japanese rice
Q9ZUA3       511 AGTNNDS------------VPGVLHDLLQKEVITLRKAANDKDQSLRDKDEAIEMLAKKVETLTKAMEVEAKKMRREVAA 578 thale cress
EEF36422     510 VTETEDT------------VPGVLYDLLQKEVVALRKAGHEKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAA 577 castor bean
XP_006856278 550 KERELTPRRVQ-KDPLHKSSTMII-SKravKSV 580 Amborella trichopoda
ERM98119     549 MEKEVAAMRVG-KGHDLRTKRLSN-SK---VTS 576 Amborella trichopoda
XP_003553384 547 MEKEVAAMRIS-KEHDHRARRASA-PRgavNSQ 577 soybean
CBI30130     566 MEKEVAAMRVS-KEHDPRARRPSA-PRgsqlls 596 wine grape
XP_002267938 554 REKEAISTKAD-EN--KKIRNTDS-SKrrvAka 582 wine grape
XP_002980874 547 MEKEVAAMRVD-KEQENRARRLSI-AKgsvNSS 577 Selaginella moellendorffii
ERN02085     580 MEKEVASMRAD-NEHGQRGRRLSGsSKgllNNA 611 Amborella trichopoda
XP_009404137 574 MEKEVAAMRVE-KEQDNKSKRLGG-SKglaNSS 604 wild Malaysian banana
EEE65458     531 AMRVDKEQEVK-ARRLGSSKGTGS-SQv-lSGR 560 Japanese rice
Q9ZUA3       579 MEKEVSAMRVDnKGSDSRTRRHSTnSKgasTTA 611 thale cress
EEF36422     578 MEKEVAAMRVE-KEHENRAKRFGS-SKgpvGAA 608 castor bean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap