5N8O


Conserved Protein Domain Family
TraI

?
pfam07057: TraI 
DNA helicase TraI
This family represents a conserved region approximately 130 residues long within the bacterial DNA helicase TraI (EC:3.6.1.-). TraI is a bifunctional protein that catalyzes the unwinding of duplex DNA as well as acts as a sequence-specific DNA trans-esterase, providing the site- and strand-specific nick required to initiate DNA transfer.
Statistics
?
PSSM-Id: 399797
View PSSM: pfam07057
Aligned: 4 rows
Threshold Bit Score: 198.618
Threshold Setting Gi: 502965061
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5N8O_A                1434 VALSRMKQHVQVYTDNRQGWTDAINNAVQK-GTAHDVLEPKPDREVMNAQRLFSTARELRDVAAGRAVLRQAGLAGGDSP 1512
wugsc:KPN_pKPN4p07159 1433 VALSRMKQHVQVYTDNREGWIKAIKNSPEK-ATAHDILEPRNDRAVKTADLLFGRARPLDETAAGRAALQQSGLAQGSSP 1511 Kleb...
WP_013200037          1448 INVSRVRDHVQVVTDGLDKWVATLREKDTGpATAHDALTPEPARA--QARSIWAMGQAVSKTAIGRAFLREQGLKDSPVT 1525 Erwi...
Q93GL4                1430 VALSRMKQHVQVYTDDRQGWVKAINSAEQK-GTAHDVLEPKSEREMMNAERLFSTARELRDVAAGRAVLRNAGLAQGDSR 1508 Salm...
5N8O_A                1513 ARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPLTTDDGnG-LRGF 1557
wugsc:KPN_pKPN4p07159 1512 GKFISPGKKYPQPHVALPAFDKNGKAAGIWLSPLTDRDG-R-LEAI 1555 Klebsiella pneumoniae subsp. pneumonia...
WP_013200037          1526 ARVIPPTHKYPVPHLTLPAYDGNGKSAGLTLIPLQPDTG----RIK 1567 Erwinia billingiae
Q93GL4                1509 ARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPLTTDDG-AgLRGF 1553 Salmonella enterica subsp. enterica se...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap