Conserved Protein Domain Family
OCIA

?
pfam07051: OCIA 
Ovarian carcinoma immunoreactive antigen (OCIA)
This family consists of several ovarian carcinoma immunoreactive antigen (OCIA) and related eukaryotic sequences. The function of this family is unknown.
Statistics
?
PSSM-Id: 399793
View PSSM: pfam07051
Aligned: 16 rows
Threshold Bit Score: 113.914
Threshold Setting Gi: 1008758365
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDW56857      21 ADYQFSAEEVKALRECNTESFFQRSLPFGTGLGLLAYFGVKNGYLQGHVKYGAVPKVVMGVILGYFVGKFSYQQKCAEKI 100 Drosophila sech...
XP_028026848  28 SPYKFSQDELKVLAECNQESFFQRCLPLGTVLGLGTFAAIQKGHLKPNPRFGPFPKVTLAVVVGYFLGKLSYQQACAEKL 107 wild silkworm
XP_008185367  20 VFYQFSPEETRVMNECNKESFFQRSLPLSLITGAVSYAAVNAGYLKRSVKWGPWPKVMFGGLIGYLIGKYSYQTICAEKL 99  pea aphid
XP_015853843  31 KLHIHRGEIAKIIRECQEESFWKRALPFSLISMLVTQGLVHQGYLAANPRFGSLPKVALAGLLGFGLGKASYIRVCQSKF 110 prairie deer mouse
XP_005998626  23 SSYVLKEDVNKIIKECKEESFWYRALPLSITSMAVTQGLVYQGVLSRSQRFGSLPKVVVAGILGFVIGKISYFGVCRKKF 102 coelacanth
Q6NYD7        25 SAYIPTEEEKRVFRECNSESFWYRSLPFSAIAVGITQVLVAKGMLSPSPRFGALPKIAFAGIFGYIGGKMSYVRVCQEKF 104 zebrafish
XP_003773305  24 MDYIPTEEERKVFAECNRESFWYRSVPFSATSVLVTQGLITKGILSSHPKYGSIPKIAFACIMGYFAGKISYVKTCQEKF 103 Tasmanian devil
Q28GQ3        25 VGYIPTDDERRVFRECNEESFWYRSLPISAVSMIVTQGLISRGILTTSSRFGSLPKVAFAGLCGYLAGKVSYMKTCQEKF 104 tropical clawed...
NP_001314997  23 MDYTPTEEERRVFRECNQESFWYSSLPISVVSMAVTQLLISRGALSASGRFGSLPKLAFAGFCGYVGGKMSYMKKCIEKF 102 zebrafish
XP_005469939  23 IDYIPTEEERRVLRECNQESFFYRSVPFSVISMAITQALVARGALSASPRFGSLPKVAFAGFCGYLAGKLSYMKTCQEKF 102 Nile tilapia
EDW56857     101 MRLPNSH 107 Drosophila sechellia
XP_028026848 108 MALPGSY 114 wild silkworm
XP_008185367 100 MQLPNSE 106 pea aphid
XP_015853843 111 HSFEDQl 117 prairie deer mouse
XP_005998626 103 HDMGIQP 109 coelacanth
Q6NYD7       105 MKLENSP 111 zebrafish
XP_003773305 104 KRLENSP 110 Tasmanian devil
Q28GQ3       105 KRLENSP 111 tropical clawed frog
NP_001314997 103 KNLENSP 109 zebrafish
XP_005469939 103 KRLENSP 109 Nile tilapia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap