Conserved Protein Domain Family
OPA3

?
pfam07047: OPA3 
Optic atrophy 3 protein (OPA3)
This family consists of several optic atrophy 3 (OPA3) proteins. OPA3 deficiency causes type III 3-methylglutaconic aciduria (MGA) in humans. This disease manifests with early bilateral optic atrophy, spasticity, extrapyramidal dysfunction, ataxia, and cognitive deficits, but normal longevity.
Statistics
?
PSSM-Id: 399792
View PSSM: pfam07047
Aligned: 139 rows
Threshold Bit Score: 72.1603
Threshold Setting Gi: 209556810
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_014172718                    4 LPLFKLAALFVRHISKYGANQIKIQAHE-------HQRFR-RQAARYGQAIHQLNMRL----NVAVLRNyd-aeKRarek 70  Grosmannia clavigera kw1407...
3_pfamImport                    1 VPLAKLLPLVFKIVTNPVVKVLQRNVSK-------SQFWEhRVFLPMARSYNKASVRV----RLWSQGIhr-nkEQv--- 65 
XP_004225843                    5 IPLAKLLPEIFKTVTKPMVNALKRNVRK-------SPFWKdSVFIPMAQSYNKASVRV----RLWSQGIhr-nkEQv--- 69  vase tunicate...
XP_008206277                    6 FPGSALLTQLFRQLTKPASQRIVDYAAR-------HPSFRrYLLLAPGRLYHRLESHLerlkAAPMVASka-ekKP---- 73  jewel wasp...
EGI68336                        6 FPGANLIGQILRQITQPLSKAIVKRVKK-------RPLIRkYVLMQLGHFYYLCENLI----EWRQISVi---------- 64  Panamanian leafcutter ant...
A0CU80                          2 IPFKKLAALFIRTFSKPVANIIKRYALNnnnnrsfGRRIVrNSFIFLGNKYHAFDTYL----ERASIGQtn---qQ---- 70  Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00348870A   2 LPLLKALSLVGKVFSRPIVVIFKVGIQK-------IGGTPrETLVRWGNIIYNWEAWI----NRRFLGYeg-kvKE---- 65  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00191250A   2 LPLFKLFSLFVRILARPVIARTKAHTSSkl----qNQKFR-VFFVWLGNKAHRINVYI----NRTFLKLnn-qdFK---- 67  Tetrahymena thermophila SB210...
A0CNE2                          2 LPQLKLISLIVRVFARPIITSRKEVSIEkvl--msKQRFLtQQIQNLGNYYYYTDQKI----DRMYLNQnl-hdEY---- 70  Paramecium tetraurelia...
A0BUL1                          2 LPLFKVFSLIVRVFARPVIARTKAAHLKkaq--sgHTTWIkQFYVRLGNFQHKWDQKI----DSKFMGIdkkssDF---- 71  Paramecium tetraurelia...
XP_014172718                   71 aeaaeaptvktkeqaereerlkqkeaadrakygttakeahpatvimrtsdasipaasaaaatatsstsssadstrgpthf 150 Grosmannia clavigera kw1407...
3_pfamImport                      --------------------------------------------------------------------------------    
XP_004225843                      --------------------------------------------------------------------------------     vase tunicate...
XP_008206277                      --------------------------------------------------------------------------------     jewel wasp...
EGI68336                          --------------------------------------------------------------------------------     Panamanian leafcutter ant...
A0CU80                            --------------------------------------------------------------------------------     Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00348870A     --------------------------------------------------------------------------------     Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00191250A     --------------------------------------------------------------------------------     Tetrahymena thermophila SB210...
A0CNE2                            --------------------------------------------------------------------------------     Paramecium tetraurelia...
A0BUL1                            --------------------------------------------------------------------------------     Paramecium tetraurelia...
XP_014172718                  151 tsvwkRKFRALPEAKAVDL---------FADVVGAAFILVIASALVLYEYYRSASKP--DanlANLERIKDLngqLTELR 219 Grosmannia clavigera kw1407...
3_pfamImport                   66 -----EKSARLSDEAALEL---------GAEIVANSATFIVGLLAIIMQQSIVAATE--K---KKEKEEQLE---TKRIE 123
XP_004225843                   70 -----ERSAHMNDEAALEL---------GAEIVANSATFIVGLLAIIMQQSIAAATE--K---KKEKQEEQE---LMKME 127 vase tunicate...
XP_008206277                   74 ------KVKALKDEEAAML---------GSQLMIEIVIFALLALILTCDWLRSQRKS--A---LEEDRRRAE---FAELE 130 jewel wasp...
EGI68336                       65 -----TKKRPIDDDRTMEV---------GTSLLLEAIIFGFLGGVVIYETQKAADRAciA----EELQIQE----FNDIK 122 Panamanian leafcutter ant...
A0CU80                         71 -----FFIKPLTDEAAFMK---------GTDLFSDLFIYACVLGLPLYEIMRQSNES--A---KKEAIQDEK---LHKLS 128 Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00348870A  66 --------VLLSDEKALEN---------FANFFIEVVIVYGVIGYITISQGIQKHRE------MQEEKERK-----DRLE 117 Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00191250A  68 -------VQDLSEPAALEL---------GVETFYEVIIYACILGLPIIEIYRAQVES--N---EKSEKQKQV---MEGIH 123 Tetrahymena thermophila SB210...
A0CNE2                         71 --------DKLNDEDALKLvilitiilqGTEFLLEMIIYTILILVSLFEIYKTYFEQqeR---------------LQNMN 127 Paramecium tetraurelia...
A0BUL1                         72 ------FFKPLNDELALEK---------GVEFFYEILIYALLITLPTYEMYSAQQDS--K---KKSEQNTQK---LNNLM 128 Paramecium tetraurelia...
XP_014172718                  220 AAEDEH 225 Grosmannia clavigera kw1407
3_pfamImport                  124 ENLIDL 129
XP_004225843                  128 TNILEL 133 vase tunicate
XP_008206277                  131 RQKSEA 136 jewel wasp
EGI68336                      123 AKKDRL 128 Panamanian leafcutter ant
A0CU80                        129 KEVEEL 134 Paramecium tetraurelia
WGS:AAGF:cds.TTHERM_00348870A 118 EEVYYL 123 Tetrahymena thermophila SB210
WGS:AAGF:cds.TTHERM_00191250A 124 TRLQNL 129 Tetrahymena thermophila SB210
A0CNE2                        128 NTIKNL 133 Paramecium tetraurelia
A0BUL1                        129 KQIEEN 134 Paramecium tetraurelia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap