5UJ8,4XGC


Conserved Protein Domain Family
ORC3_N

?
pfam07034: ORC3_N 
Click on image for an interactive view with Cn3D
Origin recognition complex (ORC) subunit 3 N-terminus
This family represents the N-terminus (approximately 300 residues) of subunit 3 of the eukaryotic origin recognition complex (ORC). Origin recognition complex (ORC) is composed of six subunits that are essential for cell viability. They collectively bind to the autonomously replicating sequence (ARS) in a sequence-specific manner and lead to the chromatin loading of other replication factors that are essential for initiation of DNA replication.
Statistics
?
PSSM-Id: 399784
View PSSM: pfam07034
Aligned: 21 rows
Threshold Bit Score: 292.713
Threshold Setting Gi: 144581957
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5UJ8_C                18 KKRKISLPIEDYFNKGKNEPEDS--KLRFETYQLIWQQMKSENERLQEELNKNLFDNLIEFLQKSHSGFQKNSRDLGGQI 95   human
jgi:OSTLU_27761       43 APRGDEASRLNAFEPVLRDETRGarERRAAACARAWEALDGHCQRVADEANAEAFARVRRFVREQGATRVERARETEEKN 122  Ostreo...
2_pfamImport           1 KRSPENIKIQNFLQK---SGVKP--TQRWKVGQNVWKEIENSVNKLHSEVKEELFSSLVDFVRNAHLK--------DSTS 67  
XP_003063429          62 PAQPKRFTARKSFKPLVPDETVEglEARWDAYERSWASTDAHVSRVLADANRGAFEKLEAFVRGDFAERVALRDANGGAL 141  Microm...
EFA03157              26 RTKDKRT------QSLYCD------SLWYKTYKSLWESIETQIQELNNAMFSNILCSLVNFLKNCYKDTV---------- 83   red fl...
Q17D50                22 KTRRQPQKCRSIPNRAITD------TVWYGSYRKMWTKIRDQLEQLQSCSYGKILDDLLKFVEGCYRSLEYE-------- 87   yellow...
XP_001959632          29 SSKRKHSVGSSSPSNLLGTEITG--QPFYETYNQTWRQISSHITDLQQRSYARTLDQLVEFVVSQDAT------------ 94   Drosop...
4XGC_C                 1 ------------------------mQPFYEEYRKAWNQINDHIADLQHRSYARTLEQLVDFVVGQAER----------DT 46   fruit fly
XP_002049232          26 PSKRKRTEAT---SSLLGKEITT--QPFYAAYTECWNQLHSHIVQLQMASNARTLEQLVEFVTGEGAS----------NM 90   Drosop...
WGS:AAQB:GK17892-PA   30 KSKRKRSLGN---SSLLGPEITS--QPFYTAYGEIWQQLHDHILQLQQESYSRTLDQLVQYLETECGS----------QV 94   Drosop...
5UJ8_C                96 KL---REIPTAALVL-GVNVTDHDLTFGSLTEALQNNVTPYVVSLQAKDCPD---------------------------- 143  human
jgi:OSTLU_27761      123 NGg-dRRVPVGVVLAgGVNSDDHEETFAALTKSLRKSGDAHVALLRSRDLKAraga------------------------ 177  Ostreo...
2_pfamImport          68 HR---TEIPTAALVT-GVNIPDHTEMFNAIKVQITSNISPYVVVLESKHCSN---------------------------- 115 
XP_003063429         142 PQsvaQRVPVGLVLAgGVNSDDHEETFTKLTRHL-RAAGCHAALLRSRDLKAraasgggsgggggsvgggavgattiagg 220  Microm...
EFA03157              84 -----SEIPAAALLT-GINMPDHSVQFKTLKKEIKRSITPHVVTLSGEDCHS---------------------------- 129  red fl...
Q17D50                88 -----GVLPTAALLT-GINQIDHMAQFETLAGNIRNNTLSLVVLLQSRDCPS---------------------------- 133  yellow...
XP_001959632          95 -D---DLLPTAALLT-GINQPDHLSQFDALTRRLHDQRSAQVCVLQSRDCST---------------------------- 141  Drosop...
4XGC_C                47 PD---EVLPTAALLT-GINQPDHLSQFTALTQRLHAQRAAMVCVLQSRDCAT---------------------------- 94   fruit fly
XP_002049232          91 DNt--EMLPTAALLT-GINQPDHLKQFETLTQRLHAEQAARVCVLQSRDCAT---------------------------- 139  Drosop...
WGS:AAQB:GK17892-PA   95 EDs--EILPTAALLT-GINQTDHLKQFEALTQRL--QSRAKVCVLQSRDCST---------------------------- 141  Drosop...
5UJ8_C               144 ----------MKHFLQKLISQLmdccvdiksk--------eeesvhvtqRKTHYSMDSLSSWYMTVT------------- 192  human
jgi:OSTLU_27761      178 ------gtggLGVAFGVIMRQLdrt----------------------ggHWGGKSMRALRRWHEETSgarrdgliaastv 229  Ostreo...
2_pfamImport         116 ----------MKTMMKTFSQHLlchetakpddsk----deledretaylRKKFSAVT------MTNG------------- 162 
XP_003063429         221 ggggggggggLGVATRCILTQLqaatrgg--------------gtagnlRISGRSVRHLKRWYQEVTieefndaprgggg 286  Microm...
EFA03157             130 ----------LKYLVEIMVNQLvkseqlide---------dsdsdtrqiKKSQCSFTLLQAWYEELY------------- 177  red fl...
Q17D50               134 ----------MKAAVETLVAGFveesrtseq----------ddsdsrrlRRNQLNLGVLRAWYLEKH------------- 180  yellow...
XP_001959632         142 ----------LKAAVESMVFGLveddggeelgee---eedvaerdrkrlRRSQCTMKQLKSWYMNNF------------- 195  Drosop...
4XGC_C                95 ----------LKAAVETLVFGLvednaeveqmededededgaerdrkrlRRSQCTMKQLKSWYTNNF------------- 151  fruit fly
XP_002049232         140 ----------LKAAVECMVYSLmddqselvdled---addererdrkrlRRTQCTMKQLSAWYANNF------------- 193  Drosop...
WGS:AAQB:GK17892-PA  142 ----------LKGAIESMVFNLiegqleqdseel---eqeiedrdhkrlRRSQCTMKQLNSWYSNNF------------- 195  Drosop...
5UJ8_C               193 --------------------------------------QKTDPKMLSKKRT--------TSSQ-----WQ-S-PPVVVIL 219  human
jgi:OSTLU_27761      230 pspignaltvynggdsrasgegddvrarggkkraatdsRATSPARRSKRRArddveragDDERtlypvIQgRdCPVVIVV 309  Ostreo...
2_pfamImport         163 --------------------------------------SKLIESSPPKKKQa-------KLEK-----VAg--KPIVVIF 190 
XP_003063429         287 lggdrdgdrg------gdrggnenvnvngdgdgdataeRSYALRARPADAAipsdpalaAARV-----IRgPpKPIVVVI 355  Microm...
EFA03157             178 --------------------------------------QPPGTANSPKKQKt-------KHNK----------NIIVVII 202  red fl...
Q17D50               181 --------------------------------------Qh-------------------LDEK----------PNLTVIV 193  yellow...
XP_001959632         196 --------------------------------------S--------------------SERK--------P-YHLVVIL 208  Drosop...
4XGC_C               152 --------------------------------------Ds-------------------EQKR----------RQLVVIL 164  fruit fly
XP_002049232         194 --------------------------------------Gd-------------------VDKR----------RALVIIL 206  Drosop...
WGS:AAQB:GK17892-PA  196 --------------------------------------Ql-------------------EQRK----------RQLVIIL 208  Drosop...
5UJ8_C               220 KDMESFATKVLQDFIIISSQHLHEFPLILIFGIATSPIII-HRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQF 298  human
jgi:OSTLU_27761      310 EDTESFDVRVLDSFIRSVSEFVSSVPVVVLLGLATSVSSL-QGMLPAATASLMNAQAFQLWAPGQMMEAVQERVLLSPER 388  Ostreo...
2_pfamImport         191 QDLEMFSQNILTDFILMCSWHAAEMPFVFIFGIATSWLDVsQRLLPHYGLIHLSVTKFVAPSASSHLALIIDRVLLTPNH 270 
XP_003063429         356 EDTEGFDGRVLSDLLLALSDGGDALPVHVLLGVATSAATM-HGMIPAAVAAKLAVRSFHLWSPKSIMAAVQERVLLDPAR 434  Microm...
EFA03157             203 PDFENFAPKVLQDFIQIASSYLNVLPFVFVFGVATSLNAV-HRSLPCYVSSRINIQVFHSTPSTVYLNNILENILFSRQC 281  red fl...
Q17D50               194 PDFEVFSPEVLQDLLLVLNSYAAELPFVLVFGVATSVATI-HSVLPYHVTSKIKLSIFQSEPSVANLNKVLESVLLTPYC 272  yellow...
XP_001959632         209 PDFECFSAGVLQDLILILCAHCDELPFVLVLGVATAVSAV-HGTLPYHVSSKIRLRVFQTQAAPVGLNEVLEKVLLSPKY 287  Drosop...
4XGC_C               165 PDFECFNASVLQDLILILSAHCGSLPFVLVLGVATAMTAV-HGTLPYHVSSKIRLRVFQTQAAPTGLNEVLDKVLLSPKY 243  fruit fly
XP_002049232         207 PDFECFNASVLQDFILILSAQTGRLPFVLVLGVATAMTAV-HGTLPYHVSSKIKLRVFQTQPAPTGLNELLDQVLLSPKY 285  Drosop...
WGS:AAQB:GK17892-PA  209 PDFECFSSHVLQDFILILSSHCTALPFVLVLGVATAMTAV-HSTLPYQVTSKIRLRVFQTQAAPTGLNEVLDKVLLSPKY 287  Drosop...
5UJ8_C               299 PFKINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVL 344  human
jgi:OSTLU_27761      389 VPAFGSEVLNVLHTRFKEHDFSLAAVRRALHLLTITHFMTEPLSAV 434  Ostreococcus lucimarinus CCE9901
2_pfamImport         271 PFKLSGRCLQLILDVFLCHDFSIVNFLHILRFCVLEHFYNQPGSIL 316 
XP_003063429         435 ----------------REHDYSLSAARRAMHLLTLDHFMHRPLSAL 464  Micromonas pusilla CCMP1545
EFA03157             282 PFHLGGKVFNLFTDIFLFYDLSVSGFIQNFKYAMLEHFCYGNVMAL 327  red flour beetle
Q17D50               273 PFHLSGNMFKLLTDIFLFYDFSVKGFVEGFKYALLEHFCRGPIYAL 318  yellow fever mosquito
XP_001959632         288 AFHLSGKAFKFLTHIFLYYDFSVHGFIQGFKYCLMEHFFAGNAFAL 333  Drosophila ananassae
4XGC_C               244 AFHLSGKTFKFLTHIFLYYDFSIHGFIQGFKYCLMEHFFGGNAFAL 289  fruit fly
XP_002049232         286 AFHLSGKAFKFLTHIFLYYDFSIHGFIQGFKYCLMEHYFAGNAYAL 331  Drosophila virilis
WGS:AAQB:GK17892-PA  288 AFHLSGKAFKFLTHIFLYYDFSIQGFIQSFKYCLMEHYFAGNAFsl 333  Drosophila willistoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap