1MM4


Conserved Protein Domain Family
PagP

?
pfam07017: PagP 
Antimicrobial peptide resistance and lipid A acylation protein PagP
This family consists of several bacterial antimicrobial peptide resistance and lipid A acylation (PagP) proteins. The bacterial outer membrane enzyme PagP transfers a palmitate chain from a phospholipid to lipid A. In a number of pathogenic Gram-negative bacteria, PagP confers resistance to certain cationic antimicrobial peptides produced during the host innate immune response.
Statistics
?
PSSM-Id: 399777
View PSSM: pfam07017
Aligned: 24 rows
Threshold Bit Score: 206.359
Threshold Setting Gi: 357935094
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1MM4_A                 13 NIAQTWQQPeHYDLYIPAITWHARFAYDKEKT--DRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGW 90 
WP_015767195           37 RLHDTWEQG-QGEVLLPFYTYHMPFAYSQAKL--DSFEQNTWGLGYGRSRYDDEGNWHSLYAMGFRDSHDKFEPIVGYGY 113 Candid...
Q1H2L0                 37 RISDTWKNG-DHDLYIPLWTHHLRFAYDNDKI--DSFREFTWGLGYGRSRYNAAGNWEGVYLMAFSDSHSNVQPMLGYGH 113 Methyl...
BAK78617               36 RVDQVWQQG-QGEVYLPGYAYHLRSAYRPEKI--NSFNEQAWGFGLGRGLVDDDGDWHGLYAMAFLDSHNDPEPIAGYAY 112 Pseudo...
bbmufp:Hsero_3910      54 haANIWNQG-ESELYLSGVAHHGRGTYTKEKL--NELNEHAWGLGYGKTLRNEKGDDESLYGFVLKDSHRHPQYMAGYAY 130 Herbas...
calssnu:BYI23_A008150  40 RVMRVAHEG-TWDLYVTGYGWHID-GFDNR----SELNPWSYGGGAGKHWTDANGNEDILFAFAFSDSHHNFQPIGGYAR 113 Burkho...
Q7VUS0                 35 RVDQIWNEG-GNDLYLTGYSWHNRAMYSSDKI--RSFNELAWGGGLGKSIYDEDGDWQGLYAMAFLDSHSDIEPIAGYGF 111 Bordet...
goetting:Loa_02891     49 RVHQIWDEG-ENEVYLTGYAWHNRYTYPKEKI--DSYNEAAWGGGLGKSYYDKDGDWHGLYAFAFLDSHKNVEPIAGYVF 125 Legion...
D3HNB4                 80 RLHQVWTEG-HTDLYLSGYAWHNRFTYSAERIreKKYNELAWGGGLGKGFFDEKGNWHGLYAFAFLDSHRNVEPTAGYAY 158 Legion...
Q5ZZI5                 40 RIHQTWTEG-HDDMYFSGYAWHNRYVYSNEKI--KSYNETAWGGGLGKSLFDEKGNWHGLYAIAFLDSHRHLEPAVGYAY 116 Legion...
1MM4_A                 91 ESTWRPlADENFHLGLGFTAGVTARDNW-NYIPLPVLLPLASVGYGPVTFQMTYIPGTY----NNGNVYFAWMR 159
WP_015767195          114 QWMWGE-R-DGLHAGLGYTVFVTARSDIaNYFPFPGILPIASVNYRRSALSMSYVPGGN----GNGNVLFFWAR 181 Candidatus A...
Q1H2L0                114 QWMMGP-R-SGLHAGVGYTAFLTSRADIyKNIPIPGVLPIASLNYRQYSVNTSYVPGGR----GNGNILFFWSR 181 Methylobacil...
BAK78617              113 QSLHHF-S-ENWQAGLGFTAFLTSRSDTlHYFPVPGVLPLASVQYKRLALMGTYIPGGK----GNGNVVFLFAR 180 Pseudogulben...
bbmufp:Hsero_3910     131 EWVFPI-AKTGLEVGLGGTAMLMSRQDYfHSVPFPVPLPLASIGTKKGKIMFAYVPRLSan-kNNGDVLLIFGR 202 Herbaspirill...
calssnu:BYI23_A008150 114 QWYTKP-VLGGLQAGGGFFVGVTARSDIaHYLPLPLALPIGSVRFQRASAMATFIPRIPg--lNDGDVAFFWGR 184 Burkholderia...
Q7VUS0                112 QKIGRI-G-ADTRLGIGYTVFLTSRSDImSRVPFPGILPLVSAGYRDATLYATYIPGGK----GNGNVLFMFGR 179 Bordetella p...
goetting:Loa_02891    126 LKTAHL-N-EHMNVGAGVTLFVTARPDIfHGVPFPGALPAVSFSYRKATLGALYIPGAS----GAGNVLFLLGk 193 Legionella o...
D3HNB4                159 LRVANI-T-KEFKAGLGFSVLVTARPDIfHNIPFPGAVPWAGIFYKKLSVKAAYIPGSS----TNGNVLYVVgt 226 Legionella l...
Q5ZZI5                117 LKTASV-N-KDLKAGLGYSVLVTSRVDY-DNVPIPGALPWAALFYKRITIAATYIPGSSreghENGNVLYMLGk 187 Legionella p...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap