Conserved Protein Domain Family
VirC1

?
pfam07015: VirC1 
VirC1 protein
This family consists of several bacterial VirC1 proteins. In Agrobacterium tumefaciens, a cis-active 24-base-pair sequence adjacent to the right border of the T-DNA, called overdrive, stimulates tumor formation by increasing the level of T-DNA processing. It is thought that the virC operon which enhances T-DNA processing probably does so because the VirC1 protein interacts with overdrive. It has now been shown that the virC1 gene product binds to overdrive but not to the right border of T-DNA.
Statistics
?
PSSM-Id: 148565
View PSSM: pfam07015
Aligned: 4 rows
Threshold Bit Score: 386.155
Threshold Setting Gi: 122294262
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q07GJ4         1 MNLITFASLKGGAGKTTSLMAACGSLVSRGTRVGLFEADDNQPLHAWREYAQGKGTWNDACEIANAMDLAAFEQAYEHFE 80  Roseobacter den...
CAK11664       1 MQLVTCCSFKGGAGKTTALMGLCSALAADGKTIALFEADENRPLSKWKENATRRNAWDPLCEIFITDELPLLEVAYEEAA 80  Rhizobium legum...
Q9F451        13 MQLLTFCSFKGGAGKTTALMGLCAALANDGKRVALFDADENRPLTRWRENALQSSTWDPRCEVYSADEMPLLEAAYENAE 92  Agrobacterium t...
WP_011654590   1 MKLITCCSFKGGAGKTTALMGLCSWLASKKRRVALFEGDENRPLTKWKENALRNGAWDHQCEVFVADELPLLEDAYQQAE 80  Rhizobium legum...
Q07GJ4        81 TSGYDIALADTQGGGSEFNATIIASSDLIVIPSALTRLDLDSTLDTYAVVDEILeQTETPDIPVAILITQMPSRRLTSAQ 160 Roseobacter den...
CAK11664      81 GRGFDYCLVETHHGSSELNNTVIASSNLLLIPTMLTPLDADEALATFRYIIELL-IGENLAIPAAILRQRVPANRLNSSE 159 Rhizobium legum...
Q9F451        93 LEGFDYALADTRGGSSELNNTIIASSNLLLIPTMLTPLDIDEALSTYRYVIELM-LSENLAIPTAVLRQRVPVGRLTTSQ 171 Agrobacterium t...
WP_011654590  81 GAGFHYALADTHGGLSELNNVIVASSDFLLVPTMLTPLDIDEALATYRYIVELL-LAEELQTHTAILRQRVPVGRLTVSQ 159 Rhizobium legum...
Q07GJ4       161 SFCLDIIEQLPSFDCTLPYRSAFADIKSLGMLHIYREALSQIPSKRIAATHITTAIADADRLADTLLEALEA 232 Roseobacter denitrifica...
CAK11664     160 RLISEMLSTLPLADTPMHERDAFAAMKDRGMLHLNLRNAAANSSMRLTLRNLEAAMEDLRSLGKFVSSTVEH 231 Rhizobium leguminosarum...
Q9F451       172 RRMSEMLESLPVVPSPMHERDAFSAMKERGMLHLTLLNMGTDPTMRLIERNLRIAMEEVVVISKLISKILEA 243 Agrobacterium tumefaciens
WP_011654590 160 QTAYDMLERLPVFDVPMYERDAFAAMKERGMLHITVANLSHAPAMRLMLRNNRRALDELAMIGAFVEKALEG 231 Rhizobium leguminosarum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap