Conserved Protein Domain Family
Hs1pro-1_C

?
pfam07014: Hs1pro-1_C 
Hs1pro-1 protein C-terminus
This family represents the C-terminus (approximately 270 residues) of a number of plant Hs1pro-1 proteins, which are believed to confer nematode resistance.
Statistics
?
PSSM-Id: 399776
View PSSM: pfam07014
Aligned: 10 rows
Threshold Bit Score: 466.137
Threshold Setting Gi: 571507539
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009384846 185 MQRCRFTLGLGEPNLAGKPTIEYDLVVRPSDLHALKRSPGgSKdAKDHEDQALCTIQQILESWLFAARELLARIEQRMDA 264 wild Malaysian ...
XP_002268520 203 MRGCPYTLGLGEPNLVGKPNLEYDLVCKPSELHSLKRNPY-DH-VENYENQTLYTTSQILESWIYTAQQLLKRIAERIEE 280 wine grape
ERN09734     211 fQRAPFTLGLGEPNLSGKPVLEYDLVCKPSEVHSLKRSPLdPH-LNNHENQSLYTTHQIRESWLITAQELLKRIHETLES 289 Amborella trich...
XP_003545237 207 MMRCTYTLGLGEANLAGKKIFLYDAVCRPSEIHSLETTPF-DY-VGNCENKTLHATQQIAECWTRAVRKLLERVAESVER 284 soybean
KRH31120     188 MRRCSYTLGLGEPNLAGKPSLLYDLVCKPNEIHALKTTPY-DErVENHENHALHATHQIAESWIHASRKVLERIADAVLS 266 soybean
XP_002526872 208 MRRCPYTLGVGEPNLSGKPNLDYDTVCKPNDVRNLKKCPY-DN-LENHENQTLYTTHQILECWIQVAKELINRVIKRIES 285 castor bean
EFH54306     168 MRWCKYTLGLGEPNLAGKPYLPYDAVCRPEELHSLKNNPYsDH-IENQENQMLYTIHQILESWIYVSVNLLYRIESRIEE 246 Arabidopsis lyr...
O04203       177 MSRCKYTLGLGEQNIAGKPNLRYDAICRPNEIYSLKDNPYaDH-IDNHENQTLYIIHQILESWIYASGNLLNRIVSSIEE 255 thale cress
XP_009141857 169 MRRCKYTLGLGEQNVSNKPNLRYDAVCKPNDLYRLKDNPYaDH-VDNDENQTLYVLHQILESWIHASLSLLNRIDENINE 247 field mustard
XP_009143261 164 MRFSKYTLGLGEQNISGKPNLQYDAVCRPNELYSLRNNPYaDH-IDNNENETLYILHQIIESWLHVSSNLLKRINTSIDK 242 field mustard
XP_009384846 265 KDWVQAGSDCWLLERVWKLLSEVEDLHLLMDPDDFLRLKSQLGIKATsGSE-ALCLRSTALLQVTSSCKDLKRTVPWILG 343 wild Malaysian ...
XP_002268520 281 RDLEKASSDCWLLERIWKLLADIEDLHLLMDPDDFLRLKKQLSIKSS-PESePFCFRSRGLVEITKSSKDLKHKVPYLLG 359 wine grape
ERN09734     290 KDFKASAKNCWLLEKIWKLLAEIEDLHLLMDPDDFLRLKKQLAIKTP-TDSgAFCLRSRVLMAVSEACKDLKHRVPAILG 368 Amborella trich...
XP_003545237 285 KTLEKAARECHAVERIWKLLTEVEDVHVMMDPEDFLRLKKELGMMRNcGEMvAFCFRSRELVEVARMCRDLRQKVPEILE 364 soybean
KRH31120     267 RTFEKAAEDCYAVERIWKLLAEVEDLHLMMDPDDFLRLKNQLSVKSSgGETaSFCFRSKELVELTKMCRDLRHKVPEILE 346 soybean
XP_002526872 286 KELDKASSDCYTIERIWKVLTEIEDLHLLMDPDDFLRLKKQLVIKSD-NETaPFCFRSKALVEMTRMCKDLKHKVPEILG 364 castor bean
EFH54306     247 GKFEKASSDVYLLERIWKLLTEIEDLHILMDPEDFLKVKKQLQIKST-SPNdAFCFRSKGLVEMAKMSKELRQKVPAVLE 325 Arabidopsis lyr...
O04203       256 EKFGKASNDVYLLEKIWKILAEIEDLHMLMDPEDFLKLKKQLQIKST-GKNdAFCFRSKGLVEMMKMSKDLRQKVPAVLA 334 thale cress
XP_009141857 248 EKFGKASSDVYLLERIWRLMTEIEDLHILMDPEDFLKLKKQLQIKST-GKNdAFCFRSRGLVEMTKMSKDLRQKIPKILE 326 field mustard
XP_009143261 243 GRFGEASRDVYLVESIWKLLIEVEDLHLLMDPEDFLKLKKQLHIKTA-GKNdAFCFRSRGLVEVMKMSKGLREKVPFVLG 321 field mustard
XP_009384846 344 VEADPNGGPRVQDAAMRLFHSRRrgegdNLGKINLLQALQAVEAALKRFFFAYRQVVAAVMGSLETSGNRAvyapSEALD 423 wild Malaysian ...
XP_002268520 360 VEVDPKGGPRVQEAVMKLYREKV-----GSEKIHLLQALQAIESALKRFFYAYKQVMVMVMGSSEARVSRPll-sSDSTD 433 wine grape
ERN09734     369 VEADPSGGPSLQEEAMRLYHGHG-----NWSSIHLLQALQAIEAGLKKFFFSYQQLVIVVMGSSEAMGSHG----NPRNG 439 Amborella trich...
XP_003545237 365 VEVDPTGGPGMMEAAMKVYSEKEkr--nGFEKVHVLQGMQAIEVAMKRFFYAYKQVVAVMMGSSEAD------------N 430 soybean
KRH31120     347 VEVDPKGGPRIQEAAMKLYVSKS-----AFEKVHLLQAMQAIEAAMKRFFYAYKQVLAVVMGSSEANGNRVgl-sCDSAD 420 soybean
XP_002526872 365 VEVDPNGGPRIQEAAMRLYSEKRe---sEVEKIHLLQGLQAMEAALKKFYYGYKQLLVVVMGSLEAKGNRVlv-sPESCD 440 castor bean
EFH54306     326 VEVDPTGGPRLQEAAMKLYSRKT-----EYEKIHLLQGMQAVESAAKRFFFGYQKLVAAMIGNAEANANRTva-sHESYD 399 Arabidopsis lyr...
O04203       335 VEVDPTGGPRLQEAAMKLYARKT-----ECDKIHLLQGMQAVEAAAKSFFFGYRQLVAAMMGSAEMNATAS----QESCD 405 thale cress
XP_009141857 327 VEVDPTGGPRLQEAAMRMYARKKg----ECDKIHLLQGMQAVEGAAKSFFFAYKQLVAVMMGSSQVES-----------D 391 field mustard
XP_009143261 322 VEVDPTGGPRLQEAAMRLYARKGe----ECDKIHLLQGMQGVEAAAKRFFFAYKQVVAAVMGSAEMNT---------ECD 388 field mustard
XP_009384846 424 SLSQMFLEPPYFPSLDAAKTFLGDFWQT 451 wild Malaysian banana
XP_002268520 434 SLSQIFMEPTYYPSLDAAKTFLGDFWDH 461 wine grape
ERN09734     440 ALSQLFMDPPYFPSLDAAKTFLGDFW-Q 466 Amborella trichopoda
XP_003545237 431 GFTQIFLEPTYFPSLDAAKTFLAYYWEN 458 soybean
KRH31120     421 SLTQIFLEPTYFPSLDAAKTFLGYLWDN 448 soybean
XP_002526872 441 PLSQLFLEPTFFPSLDAAKTFLGDFWSH 468 castor bean
EFH54306     400 SLTHVFMEPPYYPSLDAAKTFLGEFWSQ 427 Arabidopsis lyrata subsp. lyrata
O04203       406 SLSQIFMEPTYFPSLDAAKTFLGEFWSH 433 thale cress
XP_009141857 392 SLSQIFMEPTYYPSLDAAKTFLGEFWGN 419 field mustard
XP_009143261 389 SVRQIFMEPTYFPSLDAAKTFLGEFWSH 416 field mustard
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap