Conserved Protein Domain Family
DUF1310

?
pfam07006: DUF1310 
Protein of unknown function (DUF1310)
This family consists of several hypothetical proteins of around 125 residues in length. Members of this family seem to be specific to Listeria and Streptococcus species. The function of this family is unknown.
Statistics
?
PSSM-Id: 399770
View PSSM: pfam07006
Aligned: 9 rows
Threshold Bit Score: 134.405
Threshold Setting Gi: 486836332
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFT83294  25 LVIILFVMVGIPCGVYFHIQGRDRkfRQEMVQVVHSQEVGELIKKGLEEWDPHAFDGKGVINTYRIDDSSIRENPMGGVD 104 Parascardovia denti...
Q8Y3M8     7 IILGIVIIVIFAIGVKFYMDEKRL--NEEMMNVIYSDEAKEAFDKDLKGMDSKAFTEEGKVHSYEIVRESIRRNPMGGIN 84  Listeria monocytogenes
Q8Y3M9     7 IVLGITVMTIFGLGVKFYMDEEKL--NTEMMNVVCSNEAKEVFNDDIKLIDTKAFTKEGLIQSYEVDKESIEPNPMGGII 84  Listeria monocytogenes
Q8Y3M7     7 VLFGIAIMIIFGLGIKFYMDEEKL--NKEMIKVIYSDEAKQVFEKRLTNLDAKAFTKEGIIQSYKIDEGSIKSNPMGGIE 84  Listeria monocytogenes
Q8Y3N0     7 IVLGITVITIFGLGVKFYMDEEKL--NKEMMNVVYSDEAKQVFEFRLKAADADAFTEKGVIQSYEIDQKSIKKNPMGGIN 84  Listeria monocytogenes
Q8DXR1     9 FIVIILLGLGFTVGGLKVTENNK---QQELWEIANSKDAKNAYQKWIYAEDEDAFKENAVIKSYDIDKESIKKNPMGGIS 85  Streptococcus agala...
Q8Y3M6     7 IATVVLVMIVAGLGVKFYMDEEKL--NKEMINVVYSDEAKRVFENGLKNLDAEALTGKGVINTYEIDKKSIKQNPMGGIN 84  Listeria monocytogenes
BAO06763  12 VLI-ITGICLLWIGGTMYMDHLKL--EEEMIRVVNSEEAKIVLEKTLKNLDSKALTSEGVIKNYKIDYKNIKRNPMGGIS 88  Enterococcus mundti...
EOH70058   9 rlmkILGIAVIIIGGIVYMKQKQL--NEEMVNMIKSDRVAQLIESELKRLDPKALAAEGIVHSYEIDYESIEPNRLGGIN 86  Enterococcus hirae ...
EFT83294 105 FDAIVNDEKKFDVSFHVDRyfigddGYGPIKSDGADPSTELTD 147 Parascardovia denticolens DSM 10105 = JCM 12538
Q8Y3M8    85 VELIINNDSEMGIEYTMDK------FNGQLRCGGASISEKLAK 121 Listeria monocytogenes
Q8Y3M9    85 VALVINKDSALKLTYTLKK------NNEELKSGGASISKELTK 121 Listeria monocytogenes
Q8Y3M7    85 VRLIINNNSELYASYTMSR------NNGVLGGGGAIISKELAR 121 Listeria monocytogenes
Q8Y3N0    85 VTLIINGNPELYIKYTMNN------FNGELSGGASVTSGNLDK 121 Listeria monocytogenes
Q8DXR1    86 VRLIINKDPNLYITCNLDRd-----NQGHLVSQSSHQSPQLTH 123 Streptococcus agalactiae serogroup V
Q8Y3M6    85 VTLHVNGDSELYVFFTLNKa-----DDKKLIDDGGGNSAKLEK 122 Listeria monocytogenes
BAO06763  89 VPLIINDNNKLLVFNLLDRn----qINGEL--------SKLKN 119 Enterococcus mundtii QU 25
EOH70058  87 VELIINQDEELTLGLVVNE------RRNQLVNDGLVLSEKLDR 123 Enterococcus hirae ATCC 9790
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap