Conserved Protein Domain Family
DUF1308

?
pfam07000: DUF1308 
Protein of unknown function (DUF1308)
This family consists of several hypothetical eukaryotic sequences of around 400 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 399767
View PSSM: pfam07000
Aligned: 18 rows
Threshold Bit Score: 240.245
Threshold Setting Gi: 341884891
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGT40826            234 LNLDISAVMLLVSNLCEpGGANFMFKEEMINKHAACERMKPAKAEVLKRMEGHKLIMSKMAFERVSEIVSTVGGAKEKER 313 Caenorha...
KHN87934            246 VNLDVTAVFVLISSLTHpGGCNYRFESNLLNAQAVLERKKPALAPLLSVIEGKKLIMCRSAYESVQSILSTVAGPEEKKR 325 dog roun...
XP_003109026        237 INLDISAVMLLVSNMCEpSGARFKFQEEMINKHVENERETPAKKPLLEKLKGHRLIMSELALEQVRKIVHYVGGPTEKIR 316 Caenorha...
Q7PHB7              209 LNVDVTTLIAYCSAMTN-GSASWEFKQPLLSEQARWERDKPVKPVLERLFDGKRLICCQTAYDSFNDILSILGGEQEKAR 287 Anophele...
XP_001842342        204 LNLDITTLIAYVSAMTN-GSSHWEYSEPLLTEQARWEREKPIKPLLDDLFHGKDLICCETAVSSFQEILSILGGSKEKTR 282 southern...
KNC25863            207 LNLDITTMLAYISNVCN-GGCNWIFQEPILTEQAEKERECPLKPILDKLFMDKRLICCATAYKSFQDIVSLLGGRKEKER 285 Australi...
WGS:AAPP:GF24777-PA 206 LNLDVTTLLAYVSALTN-GNANWVYKERLLTEQAERERASPLKPLLEKILDGKKLVCCQLAYDAFQNILDIVGGQEERKR 284 Drosophi...
XP_001983702        201 LNIDVTTMLAYTSSLTN-GGCNFVFKEPLLTEQAEKERECPVKPILEKIFEGKRLVCCQLANDAFQNILSVLGGVKEREL 279 Drosophi...
XP_014370923        232 LNLDVSAMMAYVSNMTN-GHCNYVFKQEVLTQQAAWEAERPVKPVLDRLFQGKTLVCCRTAWDDFNKIIDILGGPLEKQR 310 common y...
XP_016837845        235 LNLDVSTLLAYVTNMTN-GHANFAYIEPLLTTQAEWERCRPLKPVLDDLFHNKELVVCQTAYDNFTNIVNLIGGPNEKKR 313 jewel wasp
EGT40826            314 FAELVKAIERIPD-PVDEAVGdvakLNSVKDITPYTKRVFSCALITKTRTITANASFLEHAKQKSIYFKTIVIKPRPLTE 392 Caenorha...
KHN87934            326 AKNLFENVQVVDDkLTERAAK----LKISDKISPRSKVIFGSGDYYRAVTLSANRHFVSAANHQGINFAVILHESRALSE 401 dog roun...
XP_003109026        317 FAELVKTIESIPDeTGDVGRVs--mLSDIKGITPITKRVFSCAETTGTPTVTANHKFLKHSKAKNIYFEVIEIPPRPLTE 394 Caenorha...
Q7PHB7              288 AKELFNRVHVLPDvALEQAPKelqaLKLGGKIRPRSLQVFAFGLYHRAVTVTSNEGFTRAAKMQGLEVPVFLHDARALTE 367 Anophele...
XP_001842342        283 AEQLFERVQILPDvPLPPEMQn---IRVGGKIKPRSLQIFAFGMQHEAITVTSNEGFVRAARMQGLEVPVVVHDARALTE 359 southern...
KNC25863            286 AQELAKRIEILPDvATIPEELa--tIKYSGKINERSLLIFAFGMHMKAVTVTSNKAFVRSAKMQGINVPVFTHQARALTE 363 Australi...
WGS:AAPP:GF24777-PA 285 AEELMKRVTVYPDvESIPEEFs--hIRFTANVNERSLKIFSFGMARQIFTVTSNKAFVRSAKMQGINVPVFVHASVALTE 362 Drosophi...
XP_001983702        280 AVEFMKRVTVYPDvEKLPEEFs--nIRFTAKVNERSLKIFSFGMERKIFTVTSNKAFVRSAKMQGINVPVFVHASRALTE 357 Drosophi...
XP_014370923        311 TAILKEMIKVYPDdSGGVDDYprqnLKIRGHVRLRSKVIFNFGHRIKALTVSANEGFVRAALQQGVTYAVFIHESRALTE 390 common y...
XP_016837845        314 AADLMSRVKIVDDiPKGRIME----LGLGGKIKVRSRLVFASGENLKSITVSANEGFVRAARMQGIECMVFIHEPRSLSE 389 jewel wasp
EGT40826            393 QKEAFAQ 399 Caenorhabditis brenneri
KHN87934            402 QKQASAH 408 dog roundworm
XP_003109026        395 QKEANAE 401 Caenorhabditis remanei
Q7PHB7              368 DKEKTAK 374 Anopheles gambiae str. PEST
XP_001842342        360 EKEKSAR 366 southern house mosquito
KNC25863            364 AKEETAK 370 Australian sheep blowfly
WGS:AAPP:GF24777-PA 363 GKQANAK 369 Drosophila ananassae
XP_001983702        358 GKQANAK 364 Drosophila grimshawi
XP_014370923        391 GKESTAT 397 common yellow swallowtail
XP_016837845        390 MKELNAT 396 jewel wasp
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap