Conserved Protein Domain Family
Phage_lambda_P

?
pfam06992: Phage_lambda_P 
Replication protein P
This family consists of several Bacteriophage lambda replication protein P like proteins. The bacteriophage lambda P protein promoters replication of the phage chromosome by recruiting a key component of the cellular replication machinery to the viral origin. Specifically, P protein delivers one or more molecules of Escherichia coli DnaB helicase to a nucleoprotein structure formed by the lambda O initiator at the lambda replication origin.
Statistics
?
PSSM-Id: 399760
View PSSM: pfam06992
Aligned: 26 rows
Threshold Bit Score: 167.856
Threshold Setting Gi: 122300025
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KEY56950            38 KLVDTLFKQLKQVFPAARQTnLRSEADESAAKKQWIAAFAENGIHRREQLSAGMQHARAC--ESPFWPSPGQFIAWCQQ- 114 Serratia ...
jgi:Ent638_1015     38 LVINSVFGQLLAAFPAATAN--REQSEVDEIRRQWVLAFMENGITSMAQVDAGMRVARKQ--VRPFLPSPGQFVAWCKQ- 112 Enterobac...
Q083R0              32 AIVDSVFAKLRVLFPVG----APKDDVESLHKAEWVKTLAVQGVSSRDQVQMGLTRARREqgDRQFWPTPRQFALWCQP- 106 Shewanell...
WP_058066507        37 AVVDDLFERLKAHFPAWRQA-WPSELELHAAKREWLAEFMRAGIRSLEQIQAGLRFAARH--PSAWVPAPGMFVDWCFS- 112 Pseudomon...
WP_039104548        30 EIVNKLFRQLKAACPAMFHT--LNNNDENAVKRQWIIGFIENGINPT-MINSGMRIARRQ--NNPFMPSVGQFIEWCEK- 103 Frischell...
WP_017807422        36 KLVDQIFSQLFAACPAMRSQ--FDEVQLPITKRTWVLGFAENNIRTIEQVRAGMRKVRSK--PDDYFPSVGKFISWCKQ- 110 Avibacter...
jgi:Asuc_1220       21 DMVDRIFENLTASCPILLTI---SGEQLDILKQQWILGFAENEIKTFEQVKRGMAAARAK--PNGYLPSVGEFIGWCKAg 95  Actinobac...
REF_pohc:D11S_2252  32 KLVDRMFQRLKALHPAWKQA-FATTEDYNYAKQIWLEELLKAGVVTPLKLKRGLDIAATQ--ASAFFPSVGQFIAWCNT- 107 Aggregati...
ACL32275            34 RAVNQLFIQLRAIFPAWKNS-FPDADSYREAKRIWLETLVNEKITTIEQLQNGIERAKKS--KNPFWPSVGEFVEWCKT- 109 Glaessere...
jgi:HSM_0885        35 KYVDRLFVRLKAIFPGWKAA-FNSDAEYEEAKATWLQALVNNGITKAELFKRGLQLAERS--ESPFLPSVGQFIAWCKSg 111 Histophil...
KEY56950           115 GASRLFGLPDERELYDMVMKYSAERGYYQ-SAEHYPWqsyswssyswQSNACWLMVTQLYSEMRALRLTESELRKH---- 189 Serratia ...
jgi:Ent638_1015    113 -SGGALGI-TVDQVIAEYWDWRNRSFEFS-SSEQFPW----------SQPVMYHICTELRYRSTERQLTHSELTRE---- 175 Enterobac...
Q083R0             107 -TAYDYGLPDLDSAYREAKRHYHNVAGHK-------W----------SHDVVGLAVRQCGTWLFATGIEKDVLTM----- 163 Shewanell...
WP_058066507       113 --PEAFGLPGLEKAYRIAMRNTHPA----------------------QAGIARWPHPAVYHAAVAAGYLNLQRLERkvsm 168 Pseudomon...
WP_039104548       104 GMSEIYGLPTPDELVKNVIRFCECKWSDDfCNYDY------------GSDANYWLVNDLYRAMQDEYLSRDKLLIK---- 167 Frischell...
WP_017807422       111 DRFEALGLPNEDELYDRLKKFQGYGMLE---IHKFHF----------ESDAEYWLLTDLYCNNREA--TEEKLCKA---- 171 Avibacter...
jgi:Asuc_1220       96 NKYAHLGLPSADELARRAKAFMGYGFELE---DQFAF----------ASDLEYWLITDVYRKCKVNRWNDKQFDAG---- 158 Actinobac...
REF_pohc:D11S_2252 108 TDYTALGLPTPDELPARVSKFQAVYCSDG--EDKFNY----------LSDAEYWLLTDLCSRGRRDQWTPAEFRKE---- 171 Aggregati...
ACL32275           110 VDYEALGLPDEDKLYKRLQAFMAFGMEE---IQKFKF----------VSTAEYYLITGLYVRNRAGEWSDKQLKDE---- 172 Glaessere...
jgi:HSM_0885       112 NEFEELGLPTPETLLQRYQAFRASCEE----PENYPW----------QSAAEFHLVCQLKRAIYQENLTHEKLLNK---- 173 Histophil...
KEY56950           190 --CTKVLAAMIQRLEAGEDLPAP 210 Serratia sp. DD3
jgi:Ent638_1015    176 --AGVLLDMWDKRVTEGKPVPPV 196 Enterobacter sp. 638
Q083R0             164 --FTRQYEILCRKYGNGELVDVE 184 Shewanella frigidimarina NCIMB 400
WP_058066507       169 elFKRKYLEQCRRIGQGEELPPA 191 Pseudomonas sp. TTU2014-080ASC
WP_039104548       168 --AEKLIAILTKKMMTGYVIQPA 188 Frischella perrara
WP_017807422       172 --VSKALKAMAARLEAGETLPKP 192 Avibacterium paragallinarum
jgi:Asuc_1220      159 --VKETLDAWAGRLSSGESIPER 179 Actinobacillus succinogenes 130Z
REF_pohc:D11S_2252 172 --CEQALKAMAKRIESGEAIPAR 192 Aggregatibacter phage S1249
ACL32275           173 --IKKSLVKMSKRLKTGEVLPEP 193 Glaesserella parasuis SH0165
jgi:HSM_0885       174 --AQSLIKAMAKYLKEGGQLAAP 194 Histophilus somni 2336
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap