Conserved Protein Domain Family
RepA_N

?
pfam06970: RepA_N 
Replication initiator protein A (RepA) N-terminus
This of family of predicted proteins represents the N-terminus (approximately 80 residues) of replication initiator protein A (RepA), a DNA replication initiator in plasmids. Most proteins in this family are bacterial, but archaeal and eukaryotic members are also included.
Statistics
?
PSSM-Id: 399747
View PSSM: pfam06970
Aligned: 16 rows
Threshold Bit Score: 98.8879
Threshold Setting Gi: 496261586
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q03N52         17 ALFFQFPKVLMYGQQYRKLSDTAKLAYMVLKDRLEYSLRNHWVDEEGHIYFIFTNQELKDLFNCSNDKLANVKKEL 92  Lactobacillus brev...
WP_008974971   13 lpYYQFPKFLLE----LPLSQNAKLLYMLLYDRARISQKNHWLNEDGYVYFVFPITEISLKWGKCCTSVKAAMKEL 84  [Clostridium] glyc...
Q8E1X9          5 NDSYLIPKVLLQDDFYSSLSARDILVYAVLKDRQIEAPEKGWIDTDGSIYLNFKLIELAKMFSCSRTTMIDIMQRL 80  Streptococcus agal...
jgi:Amet_3992  17 FSFFRIPKVLFTDERFKELSAEAKVLYGMLLDRMGLSRVNGWLDQENRVYIIFTIEEIQESLGCSKQKAVNMMAEL 92  Alkaliphilus metal...
Q832A6         18 YSFYRIPKTLLTDRRYKGVSLEAKVLYGLLLDRMGLSARNGWLDNNGRVFLYFTQEEAMTMLGCGKDKVTKLFREL 93  Enterococcus faecalis
WP_001008418   14 yNFIRLPMVLMEDEIFESISIEAKVLYSYMLNRMGLSYKNGWIDEDGKVFIYYTMDAIKEQFNCANDKALKIINEL 89  Firmicutes
Q8CYW1         14 fNFLKVPEILVDREEFRGLSAEAIILYSILLKQTGMSFKNNWIDKEGRVFIYFTVEEIMKRRNISKPTAIKTLDEL 89  Streptococcus pneu...
WP_002575861   14 fSFTRLPNFLFEAPTFQPLSNEAKVLYAFVLRRAELSRKNGWADEYGRVYLYYPICEVVALLRCGRQKAVNTLREL 89  eubacteria
Q03XB9         23 ERFYKIPKALFENEFYANMKLETKMAYAILRDRFLLSIKNNWIDKNGDVYLIYKNSDLQTILSVGEKKVISLKKEL 98  Leuconostoc mesent...
Q03WQ8         13 ERFIMFSKALIEDDYYKKMKPESKLTYSLLRNRFNLSISNEWIDSKGDVYLYYPNEKLAEDLNVGKDKVIRIKKEL 88  Leuconostoc mesent...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap