Conserved Protein Domain Family
Mo-nitro_C

?
pfam06967: Mo-nitro_C 
Mo-dependent nitrogenase C-terminus
This family represents the C-terminus (approximately 80 residues) of a number of bacterial Mo-dependent nitrogenases. These are involved in nitrogen fixation in cyanobacteria. Note that many family members are hypothetical proteins.
Statistics
?
PSSM-Id: 399744
View PSSM: pfam06967
Aligned: 97 rows
Threshold Bit Score: 127.966
Threshold Setting Gi: 498157209
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_009543341      35 LQSLRDRLEHQEISDRTFAHRLCRLIPAQCPFERKIELFGYVLLNIPPLCKLNPLYDDLMALRFRALCYLAEEWGEDISQ 114 Crocosphaer...
WP_015143266      16 LHQVRQWLESIEINSDRLARVLCRLIPARCPFEREIKLFNRTVLHIPPLCKLNPFYEQLVELRFKALCYLADECHEDITL 95  Pleurocapsa...
jgi:Chro_2151      9 kelVCSWLDGIEIRDSKKAHLLCKAIPSSCPFEREIKFFNRILVHIPPLCKLNPFYEQVVNLRFKALCYLADECGEDIAI 88  Chroococcid...
jgi:Chro_2143      8 rdlVDQWFDKIEVRDRKIAKLLCQSIPASCPFERDIKLFGRTLFHIPPLCKLNPFYEQLVSLRFKALSYLTNESDKHKAL 87  Chroococcid...
jgi:Chro_3262     16 LRSPCQWLDSIEIHNSNLARLLCMTIPARCPFEREIKLCDRTIFRIPPLCKLNPFYEQIIGLRFKCLSYLADKCGEDVAV 95  Chroococcid...
jgi:Npun_BR083    12 LNQIRYQVEILEVHNPKLARLLCKLIPSHCPFERTVSILGRTLFHIPPLCKINPLYEQIISLCYKCLLYLVDECGEDATK 91  Nostoc punc...
Q8YLB2            14 LNQLRYQLEVIEINDARIARFLCGLIPSHCPFERTVSILGRKVFQIPPLCKLNPFYEQIVLLRFKCLMYLADDCGEDVTK 93  Nostoc sp. ...
jgi:Nos7107_4231  36 LNQLRNQLDVLEIRDDKLARLLCTIIPSHCPFERNISILGRTLFRIPPLCKLNPLYEQVVGLRFKCLMYLADECGEDVTK 115 Nostoc sp. ...
WP_015156967       8 kSNICQWLESLEIHNPKFAHLFCQLIPARCPFERTISFFGRKLVHIPPLCKLNPFYEQIVYLRFKCLCFLADECGEDVTV 87  Chroococcid...
WP_015144530      14 LQPMRLWLENVEIHNPKLARLLCKIIPAQCPFERDIKLFGHSIFHIPPLCKLNPLYEQVIGLRFKCLSYLADRCGEDVTL 93  Pleurocapsa...
WP_009543341     115 YC 116 Crocosphaera subtropica
WP_015143266      96 YC 97  Pleurocapsa minor
jgi:Chro_2151     89 YC 90  Chroococcidiopsis thermalis PCC 7203
jgi:Chro_2143     88 YC 89  Chroococcidiopsis thermalis PCC 7203
jgi:Chro_3262     96 YC 97  Chroococcidiopsis thermalis PCC 7203
jgi:Npun_BR083    92 YC 93  Nostoc punctiforme PCC 73102
Q8YLB2            94 YC 95  Nostoc sp. PCC 7120
jgi:Nos7107_4231 116 YC 117 Nostoc sp. PCC 7107
WP_015156967      88 YC 89  Chroococcidiopsis
WP_015144530      94 Yy 95  Pleurocapsa minor
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap