4ATV


Conserved Protein Domain Family
Na_H_antiport_1

?
pfam06965: Na_H_antiport_1 
Click on image for an interactive view with Cn3D
Na+/H+ antiporter 1
This family contains a number of bacterial Na+/H+ antiporter 1 proteins. These are integral membrane proteins that catalyze the exchange of H+ for Na+ in a manner that is highly dependent on the pH.
Statistics
?
PSSM-Id: 399742
Aligned: 370 rows
Threshold Bit Score: 244.614
Threshold Setting Gi: 81437996
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4ATV_D              5 HRFFSSDASGGIILIIAAILAXIXANSGaTSGWYHDFLEtpVQLRVGS--LEinKNXLLWINDALXAVFFLLVGLEVKRE 82  Escherichi...
jgi:FraEuI1c_4925  23 REFLATEAGSAVLLLGATVVALVWANSP-WSSSYDHLWNthAALRVGGas--ldLSLHHWVNDGAMAIFFMVVGLEISRE 99  Frankia in...
CAR79229           23 REFLATEAGGAVLLVIAAAAALIWANSP-VADSYHDLWEttATLGVGDaa--lsMTLHHWVNDGAMAIFFAVVGLEINRE 99  Frankia sp...
Q0RG46             26 REFLATEAGGAVLLLLAAVAALLWANSP-WSGSYDRFWSttAELRLGSag--fdMTLHHWVNDGAMAIFFAVVGLEISRE 102 Frankia al...
jgi:Namu_0893      29 RRFLATEAAGSVFLLIGTVLALAWANSP-WAASYAGLWHlpVGVEIGPla--fqMSLQHWVNDAAMAVFFCVIGLEITRE 105 Nakamurell...
WP_013883060       19 RDFLRTEAGSAVVLLVATLVALVWANSP-WSAAYDDLWHlgAGLHLGSwa--ldMPLHAWVNDAAMAVFFLVVGLEISRE 95  Cellulomon...
WP_015071616       26 QRLLSSETPAALALGLATLLAVVWAN---IGSSYESVWTseFGLKLGTieFQ--RTLREWTDEGIMSVFFFMVGLDVRRE 100 Acidipropi...
WP_019512817        7 taarsgeNTAAGLLLLFTLLAILWSNSP-WAHSYTDFWDthVGLTFGSmh--aeMSVKHLVNDALMTFFFFLVGLEVKSQ 83  Mycobacter...
AEV71939            5 krfkpgENAAAGLLLAFTLVAILWANSP-WAQTYWGLLDthVGVAFGDsh--feMSVKHLINDGLMTFFFFIVGLEVTRE 81  Mycoliciba...
A1T2V5             24 qatrtTDNTAAALLLTFTVIAILWANSP-WAQSYSTLLEthIGFGFGDhh--feMTVKHLVNDALMTFFFFIVGLEVTRE 100 Mycoliciba...
4ATV_D             83 LXQGSLASLRQAAFPVIAAIGGXIVPTLLYLAFNYADPItREGWAIPAATDIAFALGVLALLGSRVPLALKIFLXALAII 162 Escherichi...
jgi:FraEuI1c_4925 100 ATTGELRDRRAVAVPALGALGGLATPALIYWLLNRSGSG-ASGWGIAMSTDTAFVLGMLALFGPRCPDRLRLFMLTLAIV 178 Frankia in...
CAR79229          100 FTTGELRDRRTVAVPALAAVGGLTLPALIYFLFNSSGPA-AAGWGIPMSTDTAFVVGILALFGPRCPDRLRLFLLTLAIV 178 Frankia sp...
Q0RG46            103 FTTGELRDRRTIAVPALGAIGGLILPAAIYFVVNRSGPE-SNGWGIPMSTDTAFVIGILALFGPRCPDRLRLFLLTLAIV 181 Frankia al...
jgi:Namu_0893     106 IAQGDLRDRRTVTVPTLGAVGGLLVPIGIYLLFNPSGEA-AQGWGVVMSTDTAFVLGVLALFGPRCPDRIRVFLLTLAIA 184 Nakamurell...
WP_013883060       96 ATRGELRDKRTVAVPALGALGGLLVPVLLYLAVTAGTDV-QHGWGVVMSTDTAFLVGILALFGPACPDRLRLFLLTLAIV 174 Cellulomon...
WP_015071616      101 LTLGELRSGRRAVLPLAAALGGLVVPALIFLAI-AGGGEyGNAWGTVISTDTAFALGLLAVVAPRNAPRLRVFLLALAVV 179 Acidipropi...
WP_019512817       84 FVIGELTDRSRAAVPVLAALAGLIVPALVFLLFNPSGDE-ARAWGVVISTDTAFLVGALAIIGPKHPSRLRTFLLTLAVV 162 Mycobacter...
AEV71939           82 FKIGELTDRSRAAVPVVAAIAGLAVPAVIFLALNPSGEN-VAAWGVVISTDTAFLVGALAIIKPKFPGRLRIFLLTLAVV 160 Mycoliciba...
A1T2V5            101 FTIGELTDRSRAAVPVVAAAAGLIVPAIVFLAFNPSGDN-AHAWGVVISTDTAFLVGALAIIKPKFPARVRLFLLTLAVV 179 Mycoliciba...
4ATV_D            163 DDLGAIIIIALFYTNDLSXASLGVAAVAIAVLAVlnlCGARRTGVYILVGVVLWTAVLKSGVHATLAGVIVGFFIPLkek 242 Escherichi...
jgi:FraEuI1c_4925 179 DDIGAITVVAVFYTKHVNVVALVLAGVAVVAIVVlrwMGVWQLTPYLVAALLLWLAVHASGVHATLAGVLIGLLVPA--- 255 Frankia in...
CAR79229          179 DDIGAISVVAIFYTDQVDAVWLGAAAAVLVVIGVmrwMGVWRLPPYVVAALVLWVAIYSSGVHGTLAGVIIGLVLPS--- 255 Frankia sp...
Q0RG46            182 DDIGAITVVGIFYTDHLNPVGLAVAGATVLAILGlrwLRVWQLPPYILASLVLWGAIHVSGVHATLAGVLVGLLVPA--- 258 Frankia al...
jgi:Namu_0893     185 DDIGAITLMAVFYSEDPSLPALGVSVLLVGALLGlrwIGVWRLYPYVLVGIALWFAVYQSGVHATLAGVAIGLIIPA--- 261 Nakamurell...
WP_013883060      175 DDIGAITVMAVFYTDRVDVAALAASGVLVLVLLAlrwLRVWRLLPYAVVGVALWLAVHASGVHATLAGVAVGLIVPA--- 251 Cellulomon...
WP_015071616      180 DDIAALAVIAFVYTDEVTFPALGLAALGLLAVWGlerLNVWRPLPYALIGVYTWFCFQASGVHATLAGVLIALLMPV--- 256 Acidipropi...
WP_019512817      163 DDVGALLAIALFYSDQIRIWPLLLSVVLIALLAMvrlLPAARGPAYFVLGLGLWLALLQGGVHPTLAGVAVALLIPV--- 239 Mycobacter...
AEV71939          161 DDVGALIVIAVFYSDAIQAVPLAVSILLLIAIALvrfLPAARGPSYAILGFALWIALYLAGIHPTLAGVALALLIPV--- 237 Mycoliciba...
A1T2V5            180 DDVGALVAIAVFYSDAIQVGPLVVAVAVLVALALvrfLPVARGPAYAVLGVALWVALYLAGIHPTLAGVAVALLIPV--- 256 Mycoliciba...
4ATV_D            243 hgR-------------------------------------SPAKRLEHVLHPWVAYLILPLFAFANAGVSLGGvtldGl- 284 Escherichi...
jgi:FraEuI1c_4925 256 --TpprreqienvpvfvralqedstasrsalavsaaraavTPNERLQHLLHPVSAFVVVPLFGLANAGVSLDAhtlrTaa 333 Frankia in...
CAR79229          256 --ApprreqidevpiyvralredstasraalavsaakstvSTSERLQYTLHPLSAYLIVPIFGLANAGVHLDShtlaDas 333 Frankia sp...
Q0RG46            259 --VpprpdqveevpvyvralqedsnatrvglavaaakatvPANDRLQRVLHPISAFVVVPVFGLANAGVHLDGsalrTaa 336 Frankia al...
jgi:Namu_0893     262 --MppaqsvvdrsaaynralresptaervqlavlaaqatiPANDRLERALHPWTAYLIVPVFALANAGVALDAdalgSal 339 Nakamurell...
WP_013883060      252 --TaarredveavrgyardlveettaerehlaelaaraavPASDRMQRMLHPWSAYVVVPLFGLANAGVRLDAaalgDas 329 Cellulomon...
WP_015071616      257 --YplrgrdlrlasrvfnlfhqaprpdmarrvhdavsysvPLNQRLSSLLTPYVNYLVVPLFAIANAGVLLNGetisGaa 334 Acidipropi...
WP_019512817      240 --FtperdrveeavemigvfrqspnseyareaarrlrdsiSINERLQTTFTPYVSYLILPVFALANAGVQFNMqtieLav 317 Mycobacter...
AEV71939          238 --FapvrsqvedavevirafrqspnsqyartatrrlrqsiSINERLQTDVGPYVSFLVLPLFALVNAGVRLDSaslaAaa 315 Mycoliciba...
A1T2V5            257 --FtperrpveravdqirafrqspnsqyaraasrslresiSINERMQTAVGPAVSFVILPLFALVNAGVLLDGqslmTal 334 Mycoliciba...
4ATV_D            285 TSILPLGIIAGXLIGKPLGISLFCWLALRLKLAHLPEGTTYQQIXVVGILCGIGFTXSIFIASLAFGsvdpelINWAKLG 364 Escherichi...
jgi:FraEuI1c_4925 334 TSPVTHGVTAALVLGNAVGITVAATCAVRGGLGVLPGRVRYGHLLGAAVLAGIGFTISLFITELAFDse--elRDQAKIG 411 Frankia in...
CAR79229          334 TSPVTIGVAVALLVGNGIGITATSLVAMRTGLGALPGGVRYGHLVGAAVLAGIGFTISLFVTELAFTde--alAEQAKIG 411 Frankia sp...
Q0RG46            337 TSSVTLGVAAALIAGNACGISVAGVAAIRTGLGQLPGRVRYGHLLGAATLAGIGFTISLFITELAFTde--alQEQAKIG 414 Frankia al...
jgi:Namu_0893     340 GSSVTWGVAVALVLGNTVGITGAAMLTLRLGWGVLPGGVRYSHLLAAAMLAGIGFTISLFIAELAFTdp--avMEQAKIG 417 Nakamurell...
WP_013883060      330 GSRLTWAVMIALVVGNAIGITGAATLAIRMGLGDLPGRVRYGHLLGGAVLAGIGFTISLFIAGLAFDde--qhLTRAKIG 407 Cellulomon...
WP_015071616      335 TSSLTWGIVAGLVVGKAVGITLAATLVIGLLPSSRLPGLDVPRIAGAGALSGMGFTISLLVIGMAVDds--eaADEARVG 412 Acidipropi...
WP_019512817      318 RSPLTWGIIAGLVVGKFVGITAATAIVRASGLGQLAPGLTLRRVAGGAALSGIGFTISLFIVDIAISdp--vsQDLARVG 395 Mycobacter...
AEV71939          316 RSPLTWGIVAGLVLGKFIGITGATWFMSRTGLGQLAPGLRLRRVAGGAALSGIGFTISLFIVDIAIDdp--arQDQARIG 393 Mycoliciba...
A1T2V5            335 RSPLTWGVVAGLVIGKFVGITGATWLMRRTGLGVLAPGLTLRRIAGGAALSGIGFTISLFIVDIAISds--srQDQARIG 412 Mycoliciba...
4ATV_D            365 ILVGSISSAVIGYSW 379 Escherichia coli
jgi:FraEuI1c_4925 412 ILVGSLIAATLGSLL 426 Frankia inefficax
CAR79229          412 ILVGSFAAAVLGTFV 426 Frankia sp. EAN1pec
Q0RG46            415 ILAGSLVAALAGTVI 429 Frankia alni ACN14a
jgi:Namu_0893     418 ILAGSLVAAVLGSTt 432 Nakamurella multipartita DSM 44233
WP_013883060      408 ILAGSLLAAVVGSLL 422 Cellulomonas gilvus
WP_015071616      413 VLVASLLALVLAWav 427 Acidipropionibacterium acidipropionici
WP_019512817      396 VLVASVVAFALGWLl 410 Mycobacteriaceae
AEV71939          394 VIAASLIAFVAGWAi 408 Mycolicibacterium rhodesiae NBB3
A1T2V5            413 VLAASVLAFVFGWAi 427 Mycolicibacterium vanbaalenii PYR-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap