5NZV


Conserved Protein Domain Family
COPI_C

?
pfam06957: COPI_C 
Click on image for an interactive view with Cn3D
Coatomer (COPI) alpha subunit C-terminus
This family represents the C-terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit. Coatomer (COPI) is a large cytosolic protein complex which forms a coat around vesicles budding from the Golgi apparatus. Such coatomer-coated vesicles have been proposed to play a role in many distinct steps of intracellular transport. Note that many family members also contain the pfam04053 domain.
Statistics
?
PSSM-Id: 399736
View PSSM: pfam06957
Aligned: 30 rows
Threshold Bit Score: 514.907
Threshold Setting Gi: 552845443
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5NZV_H           816 GFFEGSIASKGKGGalAADIDIDtv---gTEGWGEDAELQLDEdg---------fvEAPEGLGEDVLG----KGQEEGGG 879  house mouse
Q9AUR8           816 GIFEGGLDATGKAE--L--EEDDea---aGADWG-DEDLDMVDasea------manGGDGFDAEEGEAneedG---EEGG 878  Japanese rice
Q6RYF4           816 GIFEGGLDATGRAE--Q--EEDYdd---aGGDWG-DEDLEIVDasav-------ienGDAGHADESETneedGE--EEGG 878  domesticat...
XP_004238316     816 GIFEGGLDSTVRGG--H--EEYEea---aDADWG--ESLDIGEven-------lqnGDISMVLDDEEGke-eND--EEGG 876  tomato
XP_009101857     822 GIFEGGLESAARGG--AVDEEEEed---aGGDWG--DALDMVDvdg-------menRDIEAILAEAEGaeedND--EEGG 885  field mustard
Q94A40           816 GIFEGGLESADRGG--TVDEEDV------EGDWG--EELDI-Nvdg-------menRDIEDILAAAEAgeeeND--EEGG 875  thale cress
ERM96351         816 GIFEGGLDNTGRGG--D--EEEEea---aVADWG--EDLDIVEssg--------qnGHVDAEVEGGGEqe-eKS--EEGG 875  Amborella ...
ERN04739         604 GIFEGGLEN--RGK--TAHEGEEea---aDANWG--EDLEIIEmeg--------pnGDLE-IIGDEEViedgDG--EEGG 663  Amborella ...
jgi:OSTLU_24382  815 GFFEGVLSGEIAGD--EYAEDDVmgmggvGLGWG-DADIDIGDdervd----plakAGIAPDVEFD------DVDNENDG 881  Ostreococc...
XP_003057643     821 GFFEGVLSGEVDAS--AYAEGGFdd--eaGAGWGDDLDIDLGGdddkekeedplaaAGLAAGSDEEKEggdgSD--SDAG 894  Micromonas...
5NZV_H           880 WDveEDLELPPELDVPSGVSgs---aeDGFFVPPTKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVIQFGPYK 956  house mouse
Q9AUR8           879 WDl-EDLELPPEAETPKNAGna----rSAVFVAPPPGMPVSLIWTQKSSLAGEHAAAGNFDTAMRLLSRQLGIKNFAPLK 953  Japanese rice
Q6RYF4           879 WDl-EDLELPPEADTPKATGaa----rSALFVAPTPGMPVSQIWTQKSSLAGEHAAAGNFDTAMRLLSRQLGIKNFAPLK 953  domesticat...
XP_004238316     877 WDl-EDLDLPPDTDTPKTASna----rSSVFVTPNPGMPVSQIWVQKSSLAAEHAAAGNFDTAMRLLSRQLGIKNFSPLK 951  tomato
XP_009101857     886 WGelEGLDLPPELDTPKASAna----rSSVFVTPTQGMPVSHIWSQKSSLAAEQAAAGSFDTAMRLLNRQLGIKNFAPLK 961  field mustard
Q94A40           876 WGl-EDLVLPPELDTPKASAna----rSSVFVTPPQGMPVSQSWSQKSSLAAEQAAAGSFDTAMRLLHRQLGIKNFTPLK 950  thale cress
ERM96351         876 WDl-EDLELPPEVESANASTnv----rSTVFVAPTPGMPVSQIWTQKSSLAGEHAAAGNFDTAMRLLSRQLGIKNFAPLK 950  Amborella ...
ERN04739         664 WDl-EDLELPPELAAAANIAgir--lsNSSFVAPTPGMPVSQIWTQKSSLAGEHAAAGNFDTAMRLLSRQLGIRNFAPLK 740  Amborella ...
jgi:OSTLU_24382  882 WGm-DELELPEELMGGAVDDtgaetfhSDVFIAPTAGVPPSRRWTEKSAVAGEHVAAGDFDSAMKLLSRQLGIVNFAPLK 960  Ostreococc...
XP_003057643     895 WDm-EDLDLPPDVGGGDDDGglv--gpSEVFVAPTAGIPPSRRWTEKSAVPGEHAAAGDFDAAMKLLNRQLGVINFAPLK 971  Micromonas...
5NZV_H           957 QLFLQTYARGRTTYQALPCLPSMYSYPNRNWKDAGLKN--GVPAVGLKLNDLIQRLQLCYQLTTVG---KFEEAVEKFRS 1031 house mouse
Q9AUR8           954 PLFVDLHMGSHSYLRALATAPIIPIAVEKGWSESASPNvrGPPALVFTFPQMEDRLKAAYKATTDG---KFPEALRQFLS 1030 Japanese rice
Q6RYF4           954 ALFLDAHMGSHTFLRAFASAPVIPVAVEKGWSESASPNvrGPPALVFSFAQMDDKLKAAYKATTEG---KFPEALRQFLN 1030 domesticat...
XP_004238316     952 QLFADLHMGSHTYLRAFSSAPVISLAIERGWSETASPNvrGPPALIFNFSQLEEKLKTAYRATTSG---KFSDALRLFLS 1028 tomato
XP_009101857     962 SMFIDLFSGSQSYLRAFSSSPVVPLAIERGWSESNSPNvrGPPALLYGFSQQEEKLKSGYKATTSGkdeKLTEALRLFLS 1041 field mustard
Q94A40           951 SMFLDLFNGSHSYLRAFSSCPVVPLAIERGWSESSSPNvrSPPALVYDFSQLDEKLKSGYKATTTG---KFTEALRLFLS 1027 thale cress
ERM96351         951 PFFLDLHMGSHSYLRAFASAPVVPIAVEKGWSESASPNvrAPPQLVYRFSMLDDKLRSAYKATTEG---KFTEALRLFLN 1027 Amborella ...
ERN04739         741 PLFMDLYLGSHAYLRGFPSAPLVPLAVERGWNEQGSANvrGPPAMVSKLSFLEERLKLAYKATTEG---KFAEALKLFLN 817  Amborella ...
jgi:OSTLU_24382  961 QHFVDLAYASHVTLEGMPASPKIPMPLGRGWSSRATGV--LPPAMICSPEILQERLKSAFKLTTEG---KFVEALKVFVG 1035 Ostreococc...
XP_003057643     972 QHFIDAAFATHASMTATSMGPNLTFPLGRDWNADAPVGktPQPALVSSLAVLEAKLKAAYKTTTEG---KFGEALKLFQS 1048 Micromonas...
5NZV_H          1032 ILLSVPLLVVDNKQEIAEAQQLITICREYIVGLCMEIERKKLPketlDQQKRICEMAAYFTHSNLQPVHMILVLRTALNL 1111 house mouse
Q9AUR8          1031 ILHTIPLIVVDSRREVDEVKELIEIVREYVLGLRMELKRKELR----DDVNRQQELAAYFTNCKLQRVHMRLVLGSAMGL 1106 Japanese rice
Q6RYF4          1031 ILYTIPLLVVDSRREVDEVKELIEIVREYVLGLRMEVKRKELK----NDATRQQELAAYFTNCKLQKVHMRLVLTSAMGL 1106 domesticat...
XP_004238316    1029 ILHTIPLIVVESRREVDEVKELIVIVKEYVLGLQMEVKRKESK----DNPVRQQELAAYFTHCNLQLPHLRLALQNAMSI 1104 tomato
XP_009101857    1042 ILHTIPLVVVESRSEVDEVKELVSIAKEYVVGLKMELKRRQKK----DDPVRQQELAAYFTHCNLQLPHLRLALLNAMTV 1117 field mustard
Q94A40          1028 ILHTIPLVVVETRREVDEVKELIVIVKEYVLGLQMELKRREMK----DDPVRQQELAAYFTHCNLQTPHLRLALLSAMGV 1103 thale cress
ERM96351        1028 ILHIIPVVVVDSRRDADEVKELIVIAKEYVLGLRMEVRRREVR----DDLKKQQELAAYFTHCNLQRIHLRLALMTAMGA 1103 Amborella ...
ERN04739         818 ILHLIPIIVVDSRREVDEVKELVVIAKEYVLALQMEVKRKELK----DDPVRQQELAAYFTHCNLQKVHLRLALMNAMGV 893  Amborella ...
jgi:OSTLU_24382 1036 IIHAITLLSVEDPSEVEDVEQLLKVAREYACALRIEIARKEVK----DDATRQAELAAYFTHSEMQPIHLSLSLRSAMSI 1111 Ostreococc...
XP_003057643    1049 IIHGVAVLLVDSRREVDEVRELLGIAREYAVALRIEMKRKEHK----EDPVRAAELAAYFTHSMMQPIHASLALRSAMSL 1124 Micromonas...
5NZV_H          1112 FFKLKNFKTAATFARRLLELGPK-PEVAQQTRKILSACEKNPTDACQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGA 1190 house mouse
Q9AUR8          1107 CYKQKNFATAEHFARMLLENNPN-EAQARRARQVQQQCS-GKKDSSELNYDYRNPFVVCGATYVPIYRGQKDVSCPYCGS 1184 Japanese rice
Q6RYF4          1107 CFKGGNYATAANFARMLLDNGPN-EAQAKKARQVLQACG-DRKDAHQLNYDFRNPFVVCGATFVPIYRGQKDVSCPYCAS 1184 domesticat...
XP_004238316    1105 CYKASNLSSAANFARRLLETNPTnESQAKTARQVLQAAEKNMRDATELNYDFRNPFVVCGATYVPIYRGQKDVTCPYCTT 1184 tomato
XP_009101857    1118 CYKAKNLATAYNFAKRLLETNPL-ESHARAARQIVKAAERNMTDTTELNYDFRNPFVICGSTCVPIYRGQKDVSCPYCTA 1196 field mustard
Q94A40          1104 CYKAKNLATASNFARRLLETSPV-DSQAKMARQVVQAAERNMTDETKLNYDFRNPFVVCGSTYVPIYRGQKDVSCPYCTA 1182 thale cress
ERM96351        1104 CFKGGNYITAANFARRILETDPP-ANQATKARQLLQACERNMKDANELNYDFRNPFVVCGATFVPIYRGQKDVACPYCMA 1182 Amborella ...
ERN04739         894 CFKGNNYNTAANFARRLLETDPP-SNQASKARQVLQICERNPKDASQLNYDFRNPFILCGLTFVPIYHGQKSVLCPYCTA 972  Amborella ...
jgi:OSTLU_24382 1112 FFKLKNYVTAATFCRRLLELNPP-VKVATQAKQVLQACERAPKDEVEVNYDPHNPFAVCSATFVPIYKGTKDCVCPTCGA 1190 Ostreococc...
XP_003057643    1125 FFKLKNFNTAANFCRRLLELNPP-VKVAQQAKQVLQACERTPTDEVELDYDSRNPFVVCSATFAPIYRGTKDVACSCCGA 1203 Micromonas...
5NZV_H          1191 CYSPE--FKGQICRVTTVTEIGKDVIGLRI 1218 house mouse
Q9AUR8          1185 RFVPS--IEGQLCTICELAVVGADASGLLC 1212 Japanese rice
Q6RYF4          1185 RFVPS--VEGQLCSICELSVVGADASGLLC 1212 domesticated barley
XP_004238316    1185 HFVPS--QQGQLCTVCDLAVVGADASGLLC 1212 tomato
XP_009101857    1197 SFVPS--QEGNICGVGDIAVIGADASGLIC 1224 field mustard
Q94A40          1183 RFVPN--QEGNICTVCDLAVIGADASGLLC 1210 thale cress
ERM96351        1183 RFVPV--LEGQLCPICDLAMVGSDASGLLC 1210 Amborella trichopoda
ERN04739         973 KFVPG--IEGQICTVCNLAVIGLDASGLVC 1000 Amborella trichopoda
jgi:OSTLU_24382 1191 HYVVE--EAGNVCGVCNLGKIGADATGLVC 1218 Ostreococcus lucimarinus CCE9901
XP_003057643    1204 KFIAEgdHVNKVCPVCNLGAVGVEAAGLVV 1233 Micromonas pusilla CCMP1545
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap