Conserved Protein Domain Family
ArsD

?
pfam06953: ArsD 
Arsenical resistance operon trans-acting repressor ArsD
This family consists of several bacterial arsenical resistance operon trans-acting repressor ArsD proteins. ArsD is a trans-acting repressor of the arsRDABC operon that confers resistance to arsenicals and antimonials in Escherichia coli. It possesses two-pairs of vicinal cysteine residues, Cys(12)-Cys(13) and Cys(112)-Cys(113), that potentially form separate binding sites for the metalloids that trigger dissociation of ArsD from the operon. However, as a homodimer it has four vicinal cysteine pairs.
Statistics
?
PSSM-Id: 399732
Aligned: 53 rows
Threshold Bit Score: 145.818
Threshold Setting Gi: 81672942
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Acfer_1548        4 KQVQIFEQAMCCPTGLCGPSIDPELLRISAVLDTLE-KH--GIPVERYNLSNAPLKFIQTPAAAEFLQHHGPEELPLILA 80  Acidamin...
WP_011938299          1 mKIEIFDPAMCCATGVCGPSVDPDLVRIQESLRQIQ-KHapAVKVARCGLLSDPQAFVTNSAVAELLEVEGPDCLPLVYV 79  Geobacte...
Q5HKC1                2 LNIEIYEEAMCCSTGVCGPEPDETLIKTNQINEYLK-QN--QIEVQRYNMNNNPNEFIQNKEVIRLIQEKGDEVLPITFI 78  Staphylo...
WP_014025150          2 QKIEIFEPAMCCSTGVCGPSVDSELLRITNLMDSLKdNK--EIKAYRYNLTSNPQVFVVNETILNLLQSKGNEILPVTMV 79  lactic s...
Q03N39                2 KKIELFEPAMCCSTGVCGPSVDQNLLMITSAFDALQgVK--TIEADRYNLSNNPDVFSERADILAAIKDDADAVLPITVV 79  Lactobac...
Q0AYF2                2 RKIEIFDPAMCCSTGVCGPSIDPELMRIATVINSLK-DK--GIIIKRHGLSNEPQDFITNKVISDLLQKEGAGILPVTLV 78  Syntroph...
jgi:Bcoa_1997         2 KNIEIFDPAMCCSTGVCGPSIDPELLRVATVINSLK-EK--GIIIKRHGLSSEPQDFISNKVISEILQKEGADILPVTLA 78  Bacillus...
goetting:Awo_c02090   2 KKVEIYEPAG-CASGVCDPMIEADLIRIEHMVQDLR-DR--GVSVSRYNVMDDMPAFMASFVVKEAIATKGIDCLPLTVV 77  Acetobac...
KUCSBL:ELI_0253       2 KKIEIFDPAMCCSTGVCGPGVDPELLRMATMVSNLQ-KA--GKEIKRHNLSEEPQAYIDNAAVNDVILKEGADALPVTVV 78  Eubacter...
WP_013382184          3 HHIEIFDPDIQCYAGECEPMGNKEYMRITTMVENLK-IA--GKDIIRYNPMQEPSLYKEMPEIRQLMDEKGIEALPAVML 79  Clostrid...
jgi:Acfer_1548       81 DGKIWMTGRYPTNEEFARMLDFNPALLVEDSArqdsekqgpgscccceeepvtgsSCC-CEEkkdsetsgsCC 152 Acidaminococcus...
WP_011938299         80 NGELISKRCYPGNEQLQEILKQAGFEVTLGEKk---------------------kASCgCGvgsc-------- 123 Geobacter urani...
Q5HKC1               79 EGNIAKTGAYITQEEADEIITVNQMr----------------------------nGGC-CGGd-------gCC 115 Staphylococcus ...
WP_014025150         80 DGTVIKTGSYPTITELQAHCETLDEVe---------------------------nNTC-CDSte------gCC 118 lactic streptoc...
Q03N39               80 DGQIVKTGAYPTIDELSDYTGLVFVPAEq-------------------------tGGC-CGGdg------gCC 120 Lactobacillus b...
Q0AYF2               79 DGAVAKTKEYPTNEEIEKWLEIEIDSKPAVi-----------------------iSSC-CGPk-------gCC 120 Syntrophomonas ...
jgi:Bcoa_1997        79 DGEIVKTKSYPTNEEFSEWLGVEISTKPQk------------------------kSGC-CGPk-------gCC 119 Bacillus coagul...
goetting:Awo_c02090  78 DGKIEMAEEYPTDFALAKWAGLPWSDLEVYADrekrektvlfgysdvekksdcddEDC-NGDc-------sCC 142 Acetobacterium ...
KUCSBL:ELI_0253      79 DGAVLKKGEYPTNDELLDWSGMSKEELVTLLIqekv----------------aqnGGC-CSGgs------gCC 128 Eubacterium cal...
WP_013382184         80 DGKIVKSGEYPSNKELLDWSGLSQEELVKTIMqk-------------------kmSNCkCGNdl------dCC 127 Clostridiales
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap