Conserved Protein Domain Family
PsiA

?
pfam06952: PsiA 
PsiA protein
This family consists of several Enterobacterial PsiA proteins. The function of PsiA is unknown although it is thought that it may affect the generation of an SOS signal in Escherichia coli.
Statistics
?
PSSM-Id: 369145
View PSSM: pfam06952
Aligned: 4 rows
Threshold Bit Score: 334.591
Threshold Setting Gi: 502965019
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004152640            2 IPSSSALVSLKPARQAALQAIMTVeEARQRGARLP-SMPHVRTFLRLLTGCSRINSDVARRIPGIHRDPKDRLSSLKQVE 80  Entero...
WP_013199995            4 IPRHLSLVPACPYRQAVAAATAEV-VKRQQGRALSgDHPWANAFLRHFCGTKTIRSGHLRRVVPEYLPRDRHGPGAASYL 82  Erwini...
Q93GP3                  2 IHSSHALVTLKPARQAALQAILTVeESRRRGARLP-ALPHARTFLRVLSGSSRINTTVAQRIPGLNWEPKNRLTSLKQVE 80  Salmon...
wugsc:KPN_pKPN4p07114   2 IHSSRSLVTLQPARQAALQAIMTVeDARQRGARLP-SMPHVRTFLRLLTGSGRINNEVPRRIPGLYRDPKDRLSNLKQVE 80  Klebsi...
WP_004152640           81 EALDMLISSHGEYCPLPLTMDVQAENFPEVLHTRTVRRLKRQDFAFTRKMRREARQVEQSWLLRQNLLGQAVTELNFQSP 160 Entero...
WP_013199995           83 RALDVLIRTRGECCPLPLSSHTGQLLFPENLTRTAERQIRRVELRVNKRLSREEREREQKRRRYQNRLAQAEIDLAFHTP 162 Erwini...
Q93GP3                 81 EALDRLISSHGEYCPLPLSVDVQAELFPEVIHARTDRRMQREKIAFNRKMRREEKALEHAWLLRQNLLGQAMTELNFQSP 160 Salmon...
wugsc:KPN_pKPN4p07114  81 EALDVLIASNGEYCPLPLSQDVQSELFPEVRHARGERRTQRQNIAFTRKMRREARKVEQSWLLRQNLLGQAVTELNFQSP 160 Klebsi...
WP_004152640          161 ETVCTWYTRWS-DEFDAAELAAPFWRWQSRFASLKELDWLRISGEPLYAVMYEIPFIVRETPEHIRVAERWQVPNKL 236 Enterobac...
WP_013199995          163 STVSSWYSRWQhQDLYEDDLQSRVYAWLRRFPSGQQADPMEWHGVKLWRQMLEISDMAGELAPDQQLADRMVLPDRL 239 Erwinia b...
Q93GP3                161 ETVNAWYTRWA-DEFDARELAQGFWQWRTRFTSLTSLDWLRDSDEPLYNVMYEIWFIVRENPVYVREAERWQVPNKL 236 Salmonell...
wugsc:KPN_pKPN4p07114 161 ETVNSWYRRWS-DEFDASELEPAFWRWQTRFTSLRDLRWLLCAHAPLYEVMHEIRFIVQESEEAILERERWLVPNKL 236 Klebsiell...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap