Conserved Protein Domain Family
PLA2G12

?
pfam06951: PLA2G12 
Group XII secretory phospholipase A2 precursor (PLA2G12)
This family consists of several group XII secretory phospholipase A2 precursor (PLA2G12) (EC:3.1.1.4) proteins. Group XII and group V PLA(2)s are thought to participate in helper T cell immune response through release of immediate second signals and generation of downstream eicosanoids.
Statistics
?
PSSM-Id: 399731
Aligned: 6 rows
Threshold Bit Score: 245.488
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4RZP3     18 YDHGAVGQASEEPtpapdgspTQDEAEEW--GLNSLRGGLESVGGYFDSVLELMGGRDGVCQHRCRYGQPPVPRPGYQMP 95  spotted green puff...
ELK09542   14 LGHGLAQSDTSPD--------AEETYSDW--GLRHIRGGFESVNSYFDSFLELLGGKNGVCQYRCRYGKAPMPRPGYKPQ 83  black flying fox
Q66KK2     14 LSMGICTEDTNQNnta--sqvPEEDSSDW--GIGTIRDGFEAVNGYFDSFLELLGGRNGVCQYKCRYGKAPLPRPDYKSP 89  tropical clawed frog
Q9EPR2     18 LLLATARGQ------------EQDQTTDWraTLKTIRNGIHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPVPRYGYKPS 85  house mouse
AAH46040   68 LSTKADGSD------------EEIKPPDWrkTINSIRSGIHRIDKYLNMALDLIGGSDGQCQFTCGDGYTPVPRPNYRPP 135 zebrafish
XP_309537  21 TGYGSNMIANLRDai----iaAEAVFGDVmkNVLHVAKKFKVVHEVFDAAVE---EN---CVYKCPGDITPT-RNKFYVP 89  Anopheles gambiae ...
Q4RZP3     96 EPDGCSSYFFGLpvpeGMDMGIPA--MTKCCNQLDMCYDTCGSNKYRCDSKFRWCLHSICSDLKKSLGFVSKVEACETVA 173 spotted green puff...
ELK09542   84 EPNGCSSYFLGL----KMDLGIPA--MTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVEACDSLA 157 black flying fox
Q66KK2     90 EPNGCSSYFLGL----KMDLGIPA--MTKCCNQLDICYDTCGANKYRCDAKFRWCLHAICSDLKKSLGFVSKVEACESVA 163 tropical clawed frog
Q9EPR2     86 PPNGCGSPLFGV----HLNIGIPS--LTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLSQNVQACETTV 159 house mouse
AAH46040  136 PPNGCGSPLFGF----QFDVGIPS--MTRCCNEHDRCYDSCGREKSDCDEQFQLCLENICQNLQMTLGLSQSVQACESAV 209 zebrafish
XP_309537  90 QSDGCGS--LGMkistEY---LPAveMEQCCNAHDICYDTCNSDKELCDLDFKRCLYRYCDDYEKNVVGDIVVKGCKAAA 164 Anopheles gambiae ...
Q4RZP3    174 DTLFNTVWTLGCRPYMNSQRAACYCQGEEKDEL 206 spotted green pufferfish
ELK09542  158 DTVFNTVWTLGCRPFMNSQRAACICVEEEKEEL 190 black flying fox
Q66KK2    164 DTVFNTVWTLGCKPFMNSQRSSCICNEEERDEL 196 tropical clawed frog
Q9EPR2    160 ELLFDSVIHLGCKPYLDSQRAACWCRYEEKTDL 192 house mouse
AAH46040  210 TVLFDTVMHLGCKPYLDSQRSACICHYEEKPDL 242 zebrafish
XP_309537 165 KMLFTGTLTLGCKSYLDSQQRCCYCPPEKTEgs 197 Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap