Conserved Protein Domain Family
CTI

?
pfam06934: CTI 
Fatty acid cis/trans isomerase (CTI)
This family consists of several fatty acid cis/trans isomerase proteins which appear to be found exclusively in bacteria of the orders Vibrionales and Pseudomonadales. Cis/trans isomerase (CTI) catalyzes the cis-trans isomerisation of esterified fatty acids in phospholipids, mainly cis-oleic acid (C(16:1,9)) and cis-vaccenic acid (C(18:1,11)), in response to solvents. The CTI protein has been shown to be involved in solvent resistance in Pseudomonas putida.
Statistics
?
PSSM-Id: 399722
View PSSM: pfam06934
Aligned: 44 rows
Threshold Bit Score: 956.653
Threshold Setting Gi: 157698375
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
zhongguo:Q91_0916   83 ASPTRLSIDAQSAKEW-REKGFFSVLEkrlqhGGENNNQSLFKNMIDLALQNPLtPNQPIPKNIQLGLKRE----NTCPA 157 Cycloclas...
OUHSC:BDW_06415     80 VEPSRLWIDMKTAHDWmDKRNFYSLNE------SNDPEKNLFYQTLAMKMF---------QKDLAVKPKKQvgagDMCPA 144 Bdellovib...
WP_011913348        76 QAPTRLFLDAEGEQAW-RRKGFHSVLD------AQGGQAALMARMLDLGRSQPLtPNAKLPAELNIGIDRA----NNCPL 144 Pseudomon...
WP_015476925        78 QDTTRLFLDAHGADAW-RRKDFWSVLD------GRDSQAALMARMIDLGHEHPLvPNAKIPEGLDLSINRT----NQCPT 146 Pseudomon...
Q9I2P9              78 QETTRLYLDAHGADAW-RRKDFWSVLE------PQDGQAALMARMLELGHSQPLqPNAKIPEGLDISINRA----NQCPT 146 Pseudomon...
BAN49379            78 QDTTRLYFDAHGAAAW-QRKGFHSVLD------ASGAQAALMARMLELGRSSPPqANAKLPADLDIDINRL----NQCAL 146 Pseudomon...
jgi:Nhal_2913       85 VEPTRLTIDANSTAGW-RDKGFFSVID-----GTEGPETSLLYRMLLLGRSQSFePNSKLPEDIKLGLKRE----NVCPT 154 Nitrosoco...
Q82UY7              85 MKPTRLGIDELTVAGW-RKRGFYSVLQ-----SDREHAQSLLKNMITLGKQYPFpPNSKLPDSIKTGFARK----NQCVS 154 Nitrosomo...
zhongguo:B5T_01476  87 AAPSRLFIDASSSGEW-RNRGFFSVLE-----GRQTMDEGLLYQMLVLGRHHRFePNSKLPEEIQLGLGRA----NVCPA 156 Alcanivor...
Q0VNV0              95 ISPTRLFKDAQTTAQW-RDKGFYSVID-----STSGLQDSLLYQMLALGKKHSFkPNQKLPDDIVLGLARQ----NECPA 164 Alcanivor...
zhongguo:Q91_0916  158 P-GEFSDYAKNNPHGGMPLAVAGLNESEAQTLSTWLSEGAKiVTK------NIDISPEHQAMIVQWETWLNSNDKRTALV 230 Cycloclas...
OUHSC:BDW_06415    145 NsEELASFQKMMPESGMPYGLPALTGDELGVIKEWISLGAL-GPSeaalkqSQQIPSALATQIKEWEKFLNAKDLKHRLV 223 Bdellovib...
WP_011913348       145 P-DEFDGYARKSQHGGMPFAVTGLSDQEYATVQRWLEQGGAvEPR------QLQPSAREATQIEQWERLLNTPGPRGSLV 217 Pseudomon...
WP_015476925       147 P-ETIDDFVAKNPRSGMPFAVTGLTDRQRSTIKDWLAQGAPvDEQ------AWQPGAGEAEQIASWESFLNQPGARQSLV 219 Pseudomon...
Q9I2P9             147 P-ASIDAFIRKNPGSGMPFAVAGLSDDEYATLQKWLAAGAPvDQQ------PLRPTAAEARQVASWERFLNQPGAKQSLV 219 Pseudomon...
BAN49379           147 P-TEFDDYARKHARAGMPFAVTGLSEAEYQTLQRWLAEGGKvQEQ------VVQPSAAEARQVAEWETLLNAPGARETLV 219 Pseudomon...
jgi:Nhal_2913      155 S-EEFNDYAKHHPYEGMPLATTGLTDEELTTIRRWLQAGAPqEPP------KINLSEAEQSAINQWEALLNKKDNRSRLV 227 Nitrosoco...
Q82UY7             155 E-EEFPGYAHDHPFEGMPFGTSGLTDREYSLLAGWLNQGAAvTDE------PVTLTRDEEQTIRTWETLFNRDDKRGRLV 227 Nitrosomo...
zhongguo:B5T_01476 157 P-EDMADYAREHPLEGMPLGLPPLSEREFDLLTGWLAQGAPlEAT------PVKLTLAEQSRIRAWESWLNRENPRQRLV 229 Alcanivor...
Q0VNV0             165 P-DEFDDYAESHPMEGMPLAVAGLTDSEFTTIRQWLEQGAPlEPK------IITPTNEEQQLIADWEAFLNQRDLKHQLV 237 Alcanivor...
zhongguo:Q91_0916  231 ARYLYEHLFLGHLYFDQvnqsagnspNAGIQFYSLVRSYTPSGQKIMPVNTARPFDDVNQAFYYRLKAIEETIVHKTHIP 310 Cycloclas...
OUHSC:BDW_06415    224 SRYLYEHKFLAHLYFPE----------EPRTFFRLVRSSKACEKGVDEIATRRPNDDPGKSFHYCFQKFPGTIVMKTHLP 293 Bdellovib...
WP_011913348       218 ARWLYEHLFIAHLYF-Eg--------GEPGRFYQLVRSRTPSGEPVDAIATRRPNDDPGTRFSYRLRPISDVIVHKTHIT 288 Pseudomon...
WP_015476925       220 SRWLYEHLFLAHLYFTEr--------GEPGHFFQLVRSRTPSGQPIDPIATRRPNDDPGNTFYYRLWPIRGVIVHKTHIT 291 Pseudomon...
Q9I2P9             220 SRWLYEHLFLAHLYFPEq--------GAPGHFFQLVRSRTPSGQPIDPIPTRRPNDDPGNSFYYRLWPIQGVIVHKTHIT 291 Pseudomon...
BAN49379           220 GRWLFEHLFLAHLYF-Dg--------GETGHFFQLVRSRTPSGQPIDPIASRRPNDDPGNTFYYRLWPIQGVIVHKTHIT 290 Pseudomon...
jgi:Nhal_2913      228 ARWLYEHLFLAHLYFEDha------dKQ--HFFELVRSYTPPGEPIKIVATRRPNDAPKNPFWYRLRPLIGTIVHKSHIT 299 Nitrosoco...
Q82UY7             228 ARWLYEHLFLAYLYFPEa--------GDEPRFFELLRSSTPSGEAIIPVATVSPNSDPGGPFFYRLRPISGTIVHKRRIS 299 Nitrosomo...
zhongguo:B5T_01476 230 ARWVYEHLFLAHLYFDDgr------qGRPPHFFSLVRSYTPPGEPIEPVASRRPNGDPGAPFWYRLWPITETIVHKTHIT 303 Alcanivor...
Q0VNV0             238 ARWLYEHLFLAHLYLDKgq------dSKPAHFFKLHRSSTPPGEPIKPVATDRPNGMPPENFWYRIAPVPGTLVHKTHIT 311 Alcanivor...
zhongguo:Q91_0916  311 YRFDQQRLKHFKQLFMTPGWSVDKLPGYSYLERSNPFITYQAIPAKARYRFLLDNAEFFIRNFIRGPVCRGQIATNVIRD 390 Cycloclas...
OUHSC:BDW_06415    294 FELSPQKLKKYQEIFFAVDWKVNKLPSYENSVAENPFIAFKDIPEKARYRYLLEDAQYQVATFIKGPVCNGSMAVNSIQE 373 Bdellovib...
WP_011913348       289 YPLSATKLARVRALFFAGDWTVESLPGYGANHRANPFKTFQAIPAEARYQFMLDNAEYFVRTFIRGPVCRGQIATDVIRD 368 Pseudomon...
WP_015476925       292 YPLNPAKLARAQELFYGTAWSTDKVPGYGLQHRANPFATFAAIPAQARYQFMLDNAEYFVRTFIRGPVCRGQIATDVIRD 371 Pseudomon...
Q9I2P9             292 YPLTAKKLERVQELFFGTQWNTDKVPGYGVQSRANPFATFAAIPPRARYQFMLDNAEYFTRTFIRGPVCRGQIATDVIRD 371 Pseudomon...
BAN49379           291 YPLGAAKLARVKELFYSGDWAVDQVPGYGAQRRANPFETFQAIPAQARYQFMLDNAEYFVRTFIRGPVCRGQIATDVIRD 370 Pseudomon...
jgi:Nhal_2913      300 YPLSEKKLNRVNKLFFSDSWRVEQLPDYSDEGAANPFATFAAIPPRARYQFMLDNAEYFVRTFIRGPVCRGQFATDVIRD 379 Nitrosoco...
Q82UY7             300 YPLDQMKLRRISELFFSEDWPVGDLPGYDYTERSNPFVTFAAIPARARYQFMLDEAEYFVRTFIHGPVCRGQIATDVIRD 379 Nitrosomo...
zhongguo:B5T_01476 304 YALTDAKRERMETLFFDTPWKLEALPEYDADARANPFLTFQAIPARARYQIMLDDAEYFVRTFIRGPVCRGQIATDVIRD 383 Alcanivor...
Q0VNV0             312 FGLAKDKLARTKEHFFSTDWSVETLPGYGYEQRANPFVTFSAIPARARYQFMLDEAEYFVRTFIRGPVCRGQVATDVIRD 391 Alcanivor...
zhongguo:Q91_0916  391 QFWVMFENPKHEVYTNNPDYQHAMNPYLGLPGEKTSLLDFGSQ---WMKYETKRNQYIGQRQLTYQKIFPQGATKEHIWN 467 Cycloclas...
OUHSC:BDW_06415    374 QFWVYFLNPDSDNMVLSQSYANRVKDLLILPGMWGSDVALKETlslGKELVEHREAYRKERAKEYQKLRPKGYSLKDLWD 453 Bdellovib...
WP_011913348       369 NFWVFFQDPQHDLYVTDRRFREQATPLLAMPGQFDEMGDLLAF---WKTYRVKRNQYEQLRTKAYANAPA---DWPQIWA 442 Pseudomon...
WP_015476925       372 NFWALFQDPQHDLYVTDPDFRAQASPLLALPGQIDEMGAMLSQ---WRAYRDKRNAYEELRQDVYDDSPA--PTWADIWA 446 Pseudomon...
Q9I2P9             372 NFWVVFQDPEQDLFVTDANFRAQSEPLLALPGQIDELKNLLGL---WSAYRDKRNEYEDLRQDVYADAPP--PTWNTIWH 446 Pseudomon...
BAN49379           371 NFWALFQDPAHDLFIADAQYREQATPLLAMPGQFDEIGDLLGL---WRTYRDKRNEYEALRMQAYADAPP--PSWAHIWT 445 Pseudomon...
jgi:Nhal_2913      380 HFWTFFQDPDHDLYLTDDDYQAKITPLLTTPGQNGDLLSMGPQ---WLSYQDKRNNYLGFRQQAYLKTKPQGPSLKDIWN 456 Nitrosoco...
Q82UY7             380 HFWTLFQSPESDLFITADTYRRQAIPLLGIPGQDDDLLDAGEN---WLRYLKRHNDYLALRQQHYVAQQPQGASLAHIWN 456 Nitrosomo...
zhongguo:B5T_01476 384 QFWTVFQDPAHDLYVDDADYQRRATPLLGLPGQHDNLISLGPQ---WLKYKHKRNRYLRERQQAYARHAPNGPTWETLWD 460 Alcanivor...
Q0VNV0             392 HFWAVFQAPEQDLYITDNNYRAQVSDLLGLPGQDDDLLALGPQ---WLKYSEKRNDYLKARKQAYGTNKPKGPDWDSLWD 468 Alcanivor...
zhongguo:Q91_0916  468 GEQVNDNAFLTVFRHHDNASVTKGWKGELPLTTWLMDYPLLERTYYELVVSFNVFGSASHQTQTRLYFDLIRNSSEVNFL 547 Cycloclas...
OUHSC:BDW_06415    454 GDGVNSNAVLTVLRHDDNAVIKQGMHGDLPKTSFVLDYPLMERLVYNLVVNFDVFGNIGHQMLTRVYMDMIRMEAEDLYL 533 Bdellovib...
WP_011913348       443 G---NENALLSVFRQHDSASVRKGLIGEIPQTLWWMDYPLLERTYYQLVVNFDVFGNVSHQGQTRLYFDLIRNGAELNFL 519 Pseudomon...
WP_015476925       447 G---NDNAVLSIFRQYDSASVRKGLIGGIPQTIWWLDYPLFERTYYGLVVNFDVYGNVAHQAQTRLYFDLIRNGAEQNFL 523 Pseudomon...
Q9I2P9             447 G---NDNALLSIFRQFDSASVRKGLLGEVPQTLWLMDYPLFERTYYGLVVNFDVFGNVSHQAQTRLYFDLIRNGAEQNFL 523 Pseudomon...
BAN49379           446 G---NDNALLSIFRQFDSASVRKGLIGEVPQTIWWMDYPLLERTYYQLVVNFDVFGNVSHQAQTRLYFDLIRNGAEVNFL 522 Pseudomon...
jgi:Nhal_2913      457 GDGHNSNAALTVFRHFDNSSVKRGLLGAFPKTVWIMDYPLFERSYYELVVNFDVFGNVSHQLQTRLYFDLIRNGAEQNFL 536 Nitrosoco...
Q82UY7             457 GDGHNENALLTIFRHHNSASVVRGLAGAVPQTIWLMDYPLLEQTYYQLVVNFNVFGNVAHQVLTRLYFDLIRNGSEQNFV 536 Nitrosomo...
zhongguo:B5T_01476 461 GDGDNSNALLTIFRHHDSASVRRGLIGDLPLTTWVMDYPLFERTYYALVVNFDVFGSVSHQAQTRLYFDLIRNGAEQNML 540 Alcanivor...
Q0VNV0             469 GDGDNRNALLTIFRHHDNSSVRKGLIGDLPLTTWVMDYPLFERSYYNLVVNFNVFGSVSHQAQTRLYFDLIRNGAEQNTL 548 Alcanivor...
zhongguo:Q91_0916  548 RLMPADYREPLYKKWYPTFA-NIKTEFTYHDIDIDSPVAINYETKEPYSELLTSQLNDYPALSK-AKDSINrcdaechea 625 Cycloclas...
OUHSC:BDW_06415    534 SFLPAEQRLALRKSWYKGILaEVKMSYVFPLVAQDFPTGIQFKNNDVQAEFAGFVYKDFKPEVRgLMDPVNvknayl--- 610 Bdellovib...
WP_011913348       520 RLLPPASRQAILDDWYEKSG-QLKLLLAYTSVDRATPTQLALDSGDPKRAFARQLLARHAGINA-APDPINrcqgth--- 594 Pseudomon...
WP_015476925       524 RLMPTAARKPLLDDWYQNSG-KFKMWADYYDNDSDAPTGLFLPEKGAKNAFAQQLLKHYVALNA-RPDPINlcenga--- 598 Pseudomon...
Q9I2P9             524 RLMPVDARQPLLDDWYQNSG-KLKMWMDYQAFDDDTPSALGLPEKQPKKAFAEELLRRYGDLNA-RPDPINrcldgn--- 598 Pseudomon...
BAN49379           523 RLMPADSRAALLGDWYQNSG-KIKMWLDYQSIDKDTPTALRLPEQDPKRAFANELLTRYAGLNA-RPDPINrcsdgr--- 597 Pseudomon...
jgi:Nhal_2913      537 RWLPPQSREQYLNDWYQDTG-QLKLFLSYASIDKTSPTAVAFHSQYPKKEFLKQLLPYLGAIAG-PKDVINrcskke--- 611 Nitrosoco...
Q82UY7             537 RLLPAGQRKTILNDWYQDLG-KLKFGIVYEDIDDRSPSAERFVTENPKLELASHMLERFQSINTlSHDPLNrceqgn--- 612 Nitrosomo...
zhongguo:B5T_01476 541 RYLPAAARKPVLDDWYQKTG-KLKLFISYASVDTDTPTGIDYGTSTPKQEFDGKLLTRFAHLNA-RPDPLNrcqdeh--- 615 Alcanivor...
Q0VNV0             549 RYLPAKLRQLVLANWYQNTG-KLRLAISYESVDTDLPTSIQFDTSTPMNEFNNNLLIKFAKLNA-RPDPINrcdgen--- 623 Alcanivor...
zhongguo:Q91_0916  626 aslkketfEHQGTQINQLLSKLASTPASQLka-iNWLPEISFIKIEQLDGQFLSYSMLKNRRHSSVSFILGESLRHQDQQ 704 Cycloclas...
OUHSC:BDW_06415    611 ---kkilgNEKMDTVTKALSKVTSKRSVGKetyaRYFPEFSYLLV-IEDGKERVFSIILNREHDNISWILGEGLRLSPLD 686 Bdellovib...
WP_011913348       595 --cyrdhqPAELQRVEQALSRLTNRMAAGMpa-iLHLPEATLVRVEYAGGRREIYSLLRNRAHSNVAFMFGESLRWQPRL 671 Pseudomon...
WP_015476925       599 --cyrnsvATPLQDAEQAFSRLVSRPAAGLpv-iDQFPEATLLRVEMSDGQREIYTVLRNRAHSNVAFMAGESLRYQPGL 675 Pseudomon...
Q9I2P9             599 --cyrpgiDRELQDAEQAFSRLVSRPAAGLkv-iERFPEASMLRIRTSSGKREVYTVLRNRAHSNVAFMLGESLRYQPGL 675 Pseudomon...
BAN49379           598 --cyrpnvAPELQNAEQVLSRLVSRPAAGLrv-iDQLPEATLLRVELPDGRREVYSLLRNRAHSNVAFMLGEELRYQAGL 674 Pseudomon...
jgi:Nhal_2913      612 --crrtgsSLFAQRVDKALTILVGPTAKDLpv-iNFLPEMSLLCIYSEQGEREIYSLVRNRMHTNVAFIAGEKLRYLPER 688 Nitrosoco...
Q82UY7             613 --csridqPHWIQQADRALSGIAAQPAASLpg-iSLLPEVTFVRVQHGQNERTVYTLLRDRAHSNVAFMLGEELRYQPEK 689 Nitrosomo...
zhongguo:B5T_01476 616 --calpgaNGLEQRVQQALSPLASRRADDLpv-iDHLPEVSLLRVRGEDGDLAVYTLLRNRAHSNVAFMMGESLRYQPEL 692 Alcanivor...
Q0VNV0             624 --cqrpnvSAWKQDADHILSSISSRRAANLqa-vNFMPEVSMIHVRGNKGEQEIYSLFRNRAHTNVAFMMGESLRYQPPL 700 Alcanivor...
zhongguo:Q91_0916  705 DTLAIFPELIGSYPNLMFVISIKELNDFVFALSQADTPEAFDAVINKWGIRRMNPNFWNVLHDFTTSLNTKRPLESGIYD 784 Cycloclas...
OUHSC:BDW_06415    687 NNLMIKEGFWGSYPVQFYSIEAAEVESFVKAMRAINSDRGYQKFVQKFGVRRTSPRFWRTYDSLHEVFKSKDPVEFGFID 766 Bdellovib...
WP_011913348       672 DTLTVYPGILSSYPNFIFNLPAADVPIFVAAMEQVKAVADLERLVERWGIRRSHPQFWHYFNDLTRYLEETEPVEAGVLD 751 Pseudomon...
WP_015476925       676 DTLTIYPGVLSSYPNFMFNLKAGEANDFVTALEQVKNAADFEKVADHWGVRRSHPQFWFYFHDLEAYLRETEPVEAGVLD 755 Pseudomon...
Q9I2P9             676 DTLTIYPGVLSSYPNFMFDLPATDAEAFVGALEAAKSGEDFDKVVERWGVRRSNPQFWSYFHDLEAYIRETEPVEAGALD 755 Pseudomon...
BAN49379           675 DTLTLYPGVLSSYPNFIFNLKSTEVEDFVSAMERAKDAAAFEQVATRWGIRRTHPQFWFYFHDLAAQIRETEPVEAGELD 754 Pseudomon...
jgi:Nhal_2913      689 DTLTISPGILGSYPNFAFNIAEKELGDFVSALNSSKDEESFTQIIERWGIRRTHEDFWSLVSDFTFYLEETLPLEAGILD 768 Nitrosoco...
Q82UY7             690 DRVTVYPGITGSYPNFMFDVPAAQVGEFVAKLSKAGKIKDFEQIVETWGIRRTHPQFWEILHDITAWQKQQQPLQAGIFD 769 Nitrosomo...
zhongguo:B5T_01476 693 DTVTIYPGVLASYPNFMFHLREGELEDFVRAMERAGDESGFERLVQRFGVRRTHPEFWRYFDDLGDYLLEHEPTQAGVLD 772 Alcanivor...
Q0VNV0             701 DTLTLYPGVLASYPNFMFLVQEDQLQAFVTQMEAVKTEKDFTELVDAYGIRRTHPEFWQYFHALNQYLEKHEPTQAGILD 780 Alcanivor...
zhongguo:Q91_0916  785 INRYG 789 Cycloclasticus sp. P1
OUHSC:BDW_06415    767 LTRYS 771 Bdellovibrio bacteriovorus W
WP_011913348       752 MNRYE 756 Pseudomonas stutzeri
WP_015476925       756 MNRYE 760 Pseudomonas sp. ATCC 13867
Q9I2P9             756 MNRYE 760 Pseudomonas aeruginosa
BAN49379           755 MNRYQ 759 Pseudomonas resinovorans NBRC 106553
jgi:Nhal_2913      769 LNRYQ 773 Nitrosococcus halophilus Nc 4
Q82UY7             770 INRYE 774 Nitrosomonas europaea
zhongguo:B5T_01476 773 LNRYQ 777 Alcanivorax dieselolei B5
Q0VNV0             781 MNRYE 785 Alcanivorax borkumensis SK2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap