Conserved Protein Domain Family
SSP160

?
pfam06933: SSP160 
Special lobe-specific silk protein SSP160
This family consists of several special lobe-specific silk protein SSP160 sequences which appear to be specific to Chironomus (Midge) species.
Statistics
?
PSSM-Id: 115579
View PSSM: pfam06933
Aligned: 2 rows
Threshold Bit Score: 1093.66
Threshold Setting Gi: 74763818
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O44418   1 MNIKVILVCALVAIFFAQVAEGGPIANFVGFVISLLFSLFEVMVSVVFDVKSFTSLSTPTCNSTVPSFATRVGGGRFSGI 80  Chironomus pallidivit...
O44416   1 MNIKVILVCALVAIFFAQVAEGGPIANFVGFIISLLFSLFEVMLSVVFDVKSFTSLSNATANATMPGFASSVGGGRFTVI 80  Chironomus thummi
O44418  81 ITASFNMIAMISANVQAIQSGSGSTSGSSSSSTTSTSNSTTTTSNSTTTTTNSTTttsnstsSSNSTSSGLTSSASVVSL 160 Chironomus pallidivit...
O44416  81 MKGTFNLIAMISANIQAIQSGSGSASSNSSSSANSTTSSNSTTSSNSTTSSNSTT-------SSNSTSSGLTTGASVVSL 153 Chironomus thummi
O44418 161 IDTIAWVYQDSSVGIAYLMVSILALFYGQSVSAPPYPDLGIPALPANCSGPGVPQSVQIRAAIAYVNITIYFINMTGQQF 240 Chironomus pallidivit...
O44416 154 IDTCAWVYQDSSVGIAYLMVSILALFYGQSVSAPPYADLGIPALPANTSGAGVPQSVQIKAAITYINVTINFITLTGQQF 233 Chironomus thummi
O44418 241 EDLQGPVATDCGCPNTTSVAPLVLEWEAILAALQALANSTASANSTTSSNSTTTTTTNSTSTTTTNSTTTTNSTSSSNSS 320 Chironomus pallidivit...
O44416 234 EDLQGPVTTDCGCPNTTSVAPLVAEWEAIMAALEAFASGSASSNSTSNSTSTSNSTTTSNSTTTTNSTTSTNSTSSSNST 313 Chironomus thummi
O44418 321 TIAGCIDISANFTIALQSLQALLLQESTCAPALAANAKKSGVRDMSPCKPGktASGCAKSGEKKVKRKARLEKMRAKCRR 400 Chironomus pallidivit...
O44416 314 TIAGSIDIAANLTVALQNLQALLMQEATCAPCLAANAKKSGVREFGPCKAA--GSSCARSGQRKVKRKARLEKMRAKSRR 391 Chironomus thummi
O44418 401 AVGNRmKGSMKKRVRSRAKKFGEAAKSGVRRYRKNIKYVYIPPVMASLNAYAALMASLSESISSQSDSALNSTDQACNST 480 Chironomus pallidivit...
O44416 392 AVGNR-KGSMKKRVRSRAKKFGKAAKSGVRRYRKNIKFVYIPPVMASLNAYAALMASLSDSISYQSESALNSTDSACNST 470 Chironomus thummi
O44418 481 GSNTDAAVIAATNNVTDMFANFTAMVLNNTVAYPNCTQFADMALLMISQINDQIISCGSQSDDAESSIYFNVTINIVAMA 560 Chironomus pallidivit...
O44416 471 SNSTDEAVINATTAVTDMFVNFTAMVINNTVAHPNCTQYADMALSMVSQINEQIIACGSQSDSAQSSIYANVTISIVAMA 550 Chironomus thummi
O44418 561 QEYNNFASMSDKCTRSFANSWLWMYIKWVFYRMGMTSGIPNFLACQTKAESSLTALLASFNATINATIAAASANSSSVQS 640 Chironomus pallidivit...
O44416 551 QEYNNFASMSDKCTRSFANSWLWMYIKWVFYRMGMTSGVPNFLACQTKAQSSLTAFLASFNATVSATISAASANNSEVQS 630 Chironomus thummi
O44418 641 SEASCIESSLSDASAILAMYENAYQNCVAPGSV--PDAANTTTTSTTTTTTTTTTAAPTTTTTKAANAPFTYPLCNLQMT 718 Chironomus pallidivit...
O44416 631 SEAACIESSLAEAAVILEMFEAAYQNCTDPGSVtvPAETTTTTSTTTTTTTTTTTAAPTTTTTKAANAPFTYPLCTLIMS 710 Chironomus thummi
O44418 719 AACVAGLPTCTYPFISSAGCCPSGKTLNTGLGGRGCCK 756 Chironomus pallidivittatus
O44416 711 TTCSLGGAGCTYPLISSAGCCPSGKTLNTGLGGRGCCK 748 Chironomus thummi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap