Conserved Protein Domain Family
DUF1280

?
pfam06918: DUF1280 
Protein of unknown function (DUF1280)
This family represents a conserved region approximately 200 residues long within a number of proteins of unknown function that seem to be specific to C. elegans.
Statistics
?
PSSM-Id: 369136
View PSSM: pfam06918
Aligned: 46 rows
Threshold Bit Score: 190.078
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFO98972     185 KQQTKDFRCKKVLESIKTSVGDEAFDDFLTELCHHVAKDPKYSFSLILSDIDCFLATVKFKLSDGFLQKFKSFLKSRLGF 264 Caenorhabditis ...
EGT37018     211 NNGSKKLRFQATLENIKNVTQEDDVESYMIDFLRYLDRDEKQRFRMKLSLLQTCIIKTKATLSRYQIEMVKKYLVKFLGY 290 Caenorhabditis ...
EGT47068     186 NNSSKKIRFKETLKNIQYVSQETDVNSYIIDFLKFLEKEPDQNFRNKLTLLESCILKNKANLSRHQMDIIKKYTIKFLGH 265 Caenorhabditis ...
EGT60022     209 NHDSKKLRFKETLNHLQSISQEEDVESYMLDFGKFLDKDANQSFRSKLTLLQTCSLKSKACLSRYQLDAIKKCSIQYLGH 288 Caenorhabditis ...
3_pfamImport   1 NATSKKKKSKLVIQYIQDVTNEEDICAFLEDFIKFIEDEEGQTCSFRLSVWQCVVLKTRASITRYQIEQMKQVFVEFLGR 80 
9_pfamImport   1 NTTSKKERSRFVIKFIQEVTKEDNICEFVVDFLGFLEEEEGQTCSFRLSIWQSVVLKTRASISRFQIEQIKQVFVEYMGR 80 
EFO85124     190 NAVSKNKRKIAALAALQDIGKETNVQALLDDLINYCDQCPFQTFKYHLSVYQSVIVKTECQLSKSQLELMKKFVKEFTGK 269 Caenorhabditis ...
EGT32974     237 NHTSKKRRQLNAILVLKDIAKEEDITVLLNDIIKFCDKSEELSFKFKLSLWESVVLKSKCQLAGHQLEVMKQLFVKFTGK 316 Caenorhabditis ...
EGT51185     170 NHEYKNKRVDLAISELRKIAGQEDPTQLVNDALKKMGKQYNLTTK--LTDYEGFLFYHDAHMTRESYSKMRRSLKKKKLV 247 Caenorhabditis ...
EFO96157     162 SREAQKNRVLSGIEELEKISGDSSSEMYFRDVYKAMGKMGKMKTR--LEDGEAYALYHKVGLSRAGYEEVRTILDQRHVP 239 Caenorhabditis ...
EFO98972     265 DVFCARQKIHDLRKQHSGLDDYEITVKSVMRKT-GSrNVFVDSAVIKAKNLSVLLSRRLERLHESGQLKFR-TNNDKIIL 342 Caenorhabditis ...
EGT37018     291 DVFPQVKQACLLAKEESMINFFEASQIPSNNH--------KITSVVQCRDVKKLLEWRLENLSNSKKLIFEpFTKDDIII 362 Caenorhabditis ...
EGT47068     266 DYLPQIKSVCSLAQEKSMIELFEVKQIPRNDS--------TMTTVVYCVDVKNLLKWRLEKLSSSNQLIFDsYSGEEIVI 337 Caenorhabditis ...
EGT60022     289 DFLPPIKSVCLLAKEKSMISLFKTSQIPREDS--------KLTTVVQCTDVKALLEWRLQKLAESNQLKFD--RSEEVVI 358 Caenorhabditis ...
3_pfamImport  81 DVLPPVKTTCQLSNKISGIELYQSSIVQSNGK---------SVTTIQCIDIRRLMEWILEELSASGQLLYDdYSGEDVVL 151
9_pfamImport  81 DVLPPVKPTCQLSNKISGIDLYQASTVDSNGM---------SVTIIQCSDVRKLVAWSLEELSAAGQLIFDeYTGDDVVL 151
EFO85124     270 DIFPSVKLTCEMSKNESCIHLFQDSIVRKNEK---------DVVVVQCTDLMNLLRWRLESVGTN--LIFDsITGDDLVV 338 Caenorhabditis ...
EGT32974     317 DVLPPVKLTCQLANQSSKIELFQESVIRDKNK---------NVAVVTCVNLEQLISWRLSEIGSD--LVFDqFTGDQIVI 385 Caenorhabditis ...
EGT51185     248 NPFPPLNAIIKMELKHGPTQIYEIKQHLIDKKEgSG---KKLVISAEMKDVKEFLIGRLQELATSGKLIFDaCTGEKIWL 324 Caenorhabditis ...
EFO96157     240 NPFPSLRSIRQEEKLHASRNLFRVERIQKSDG-----GKTKDVVVVQLVDVEKFLVEKLEHLAQNDKLIFDeSTGNSIWM 314 Caenorhabditis ...
EFO98972     343 GVGGDKGGNSTKIAIVIGNVDKPNNPHGILLIGMYEGNDDYKSLKENMTSVFEQVNNMIN 402 Caenorhabditis remanei
EGT37018     363 SIGGDCGGGSTKINIIIGNVAEPNSTANISTIGVFDDSDTHDNIRKYLQPLVDQINRLEf 422 Caenorhabditis brenneri
EGT47068     338 AIGGDCGGGSTKINMIIGNVRQPNSITHISTLAVFDDSDDHENIRKYLQPLLNQLNALES 397 Caenorhabditis brenneri
EGT60022     359 AVGGDCGGGTTKINLIISNVDQPNSISHISTIGFFDDSDDHDNIRRYLQPLLDQLNNLES 418 Caenorhabditis brenneri
3_pfamImport 152 GIGGDSGGGSTKICLLIGNLRQPNSTKHIVTIAVFDDSDTYENIEKYLQPTLDQLNNLRT 211
9_pfamImport 152 GIGGDSGGGTTKLCVLFGNVRQPNSTKHILTVAVYDDADTYEKIGEFLQPLIAQLNNLET 211
EFO85124     339 VIGGDSGGGNTKICMFIANVEESNSVDNMLPIAVYDDTDSYECMAAYLPNLIEQFNTLDS 398 Caenorhabditis remanei
EGT32974     386 GLCGDSGGGNTKFCLIFGNLEHPNSVENVITVAVYDGPDTAECMQKYIPNVIQQFDNLKS 445 Caenorhabditis brenneri
EGT51185     325 AVTGDKGGEEFKLSLAIGNMNSPNSCYSLIPVGVFNDEESAENISRFIPNVVEQLNILKE 384 Caenorhabditis brenneri
EFO96157     315 CISGDKGGGEFKLCATVGNVVAPNSAYHIIPLGMFTDDEKVEAIKEYLADTIEQLNNLTE 374 Caenorhabditis remanei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap