Conserved Protein Domain Family
FAIM1

?
pfam06905: FAIM1 
Fas apoptotic inhibitory molecule (FAIM1)
This family consists of several fas apoptotic inhibitory molecule (FAIM1) proteins. FAIM expression is upregulated in B cells by anti-Ig treatment that induces Fas-resistance, and overexpression of FAIM diminishes sensitivity to Fas-mediated apoptosis of B and non-B cell lines. FAIM1 is highly evolutionarily conserved and is widely expressed in murine tissues, suggesting that FAIM plays an important role in cellular physiology.
Statistics
?
PSSM-Id: 399710
View PSSM: pfam06905
Aligned: 37 rows
Threshold Bit Score: 218.991
Threshold Setting Gi: 308474721
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_011446217    3 NDVVATWQVALPDGVHDIEFEHGTTSGKRVIRVDGKEIYKV----DWMFKLVGKEHFQVGHSkaKCTITID--AVSGFAY 76   Pacific oyster
EFO21490        5 QDTVASWSVPVQDRIYKIEFEHGTASGKRVIRVDGKEILRK----NWMFSLVGKEIFNIGKF--KCAINVE--ALGTFLY 76   eye worm
PDM63209        5 TDTVAVWHVPLQDKVHKIEFEHGTTTGRRLIKVDGKEMIRR----DWMFKLVGKEHFMLHDAi-RCTITVE--AIGTFAY 77   Pristionchus ...
EFO89424        4 SEDVILWKVPIKSTVHVVEFEHGERTGVRVLRVNGNELFRT----G-QYKITGKASFQVETL--QCRVMVK--AADPTLL 74   Caenorhabditi...
EGT58138        3 FDLVAAWNIPVQAHFHKVEFDHGQTTGKRVIRVDGKEVLRR----NWIVSLTGKEDFSIGNM--KCSINIKpsPCATIDY 76   Caenorhabditi...
XP_003099585    6 ETFIISWILPINNKQYKIQLEQAFVTNEIHIRVDEKEVYEHlcdvTNYFRPPDRNYFKIDGI--QCCVIIE--EPSFGVY 81   Caenorhabditi...
XP_003094217  159 GDCVATWNVPLHAQVHKVEFEHGTTTGKRVIRVDGKEILRR----DWMFKLVGKENFKVGDM--KCVINVE--ALGTFAY 230  Caenorhabditi...
EFO88279        4 NDRVASWNVPLRTQIHKIDFEHGTTTGKRVIRVDGVEILRR----DWMFKLVGKEVFKFGTT--HCTINVE--AIGNFAY 75   Caenorhabditi...
EGT41210        4 PNVSATWTISLQKQVHKVEFEHGTTFGRRVIRVDGKEVLRR----EWMFKLVGKENFNIGKI--LCEISIE--AVGTSGY 75   Caenorhabditi...
EGT36929        4 ADVVATWNVPLHKQVHKVEFEHGTTTGKRVIRIDGREILRR----DWMFKLVGKENFILGGM--QCTISVE--ALGTFAY 75   Caenorhabditi...
XP_011446217   77 EYTLEVNGKSLNKFRENQSKVQKAWVLTIAGNPIRVCLEKDTLDVWVNGDKVETFGEFGEEGTETHFQIG--AHSAHITA 154  Pacific oyster
EFO21490       77 EYTLEVNGKSYDKFREDVAKKFKSWTTVLDGQETRICLDKGTMDIWVNGQKMNTAGEFLENGTKTHFEIG--HSVCYVKA 154  eye worm
PDM63209       78 EYSLEVGGKTYEKFREEQSKKLQTWHCQIGESDCRICLDKQTMDVWANGKPVETTGEFGDEGTETHFQIN--GVACKVVS 155  Pristionchus ...
EFO89424       75 MYALKVDGKLLKDYKKEHHRRWQSWDCNIDGVEWKIDLDKSTMDIRANGIIVPTTGEFLDDETVTSFTVGvkATPCKIVA 154  Caenorhabditi...
EGT58138       77 EYVLEIEGNSFVKYKQDHYERNLTWEPSLMDQKGRVVFDKGNMTLWVNGSKVETVGEFTDAGTIHHFTVG--TTPCRIVT 154  Caenorhabditi...
XP_003099585   82 KHSLVVGGKAFREIKEEHYTKYDTWKPVISGKEYLVVMEKHAMNTWVDGNQIDLSRQFTDHGTVAIFHLN--GTPCKILT 159  Caenorhabditi...
XP_003094217  231 EYSLEVNGKTFNKFKEEQNKKLQSWETTIAGQEWRVVLDKDSMEVWANGKNIDTAGEFVDNGNVTHFELG--TTPCKIVA 308  Caenorhabditi...
EFO88279       76 EYSLTVNGKTYNKFKEEQNKKLQSWEMTIYGHDWRIVLDKDSMEIWANGNIIKKEAEFVDNGTETHFELG--TTPCRIVT 153  Caenorhabditi...
EGT41210       76 EYTLHVNGKTFEKFKQEQDKKLQSWETTTGGHEWRVVLYKETMEVWANGTIIATAGEFVEGGSLTHCELN--STPCRITT 153  Caenorhabditi...
EGT36929       76 EYTLDVNGKTFNKFKEELNKKLQSWETTIGGHEWRVVLDKEAMEVWANGNTVLTAGEFVDNGTLTHFELG--KTPCRIMA 153  Caenorhabditi...
XP_011446217  155 ISSgRRRDGILHKLFVDDTEIPEC 178  Pacific oyster
EFO21490      155 TSSgNKKFGFIYQLYVNNNEIISS 178  eye worm
PDM63209      156 VNSgKRSTGVVHELYltmmfggga 179  Pristionchus pacificus
EFO89424      155 IGSgNIEIGIIHKLYVNNVRVPIN 178  Caenorhabditis remanei
EGT58138      155 TSSgDKKTGVIHDLYVRDYRVPRF 178  Caenorhabditis brenneri
XP_003099585  160 ECIiGGASGMKHSFFVNN-----N 178  Caenorhabditis remanei
XP_003094217  309 VSSgKRKTGVIHLFYVNGDAVPST 332  Caenorhabditis remanei
EFO88279      154 ISSgDRKIGIIHQLYADDKLIPSV 177  Caenorhabditis remanei
EGT41210      154 KSSgNKKTGLIHTLYVNNTIVPSK 177  Caenorhabditis brenneri
EGT36929      154 QSSgNKKIGVLHTLYVNNTLVPST 177  Caenorhabditis brenneri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap