Conserved Protein Domain Family
Phage_CP76

?
pfam06892: Phage_CP76 
Phage regulatory protein CII (CP76)
This family consists of several phage regulatory protein CII (CP76) sequences which are thought to be DNA binding proteins which are involved in the establishment of lysogeny.
Statistics
?
PSSM-Id: 399702
View PSSM: pfam06892
Aligned: 10 rows
Threshold Bit Score: 211.849
Threshold Setting Gi: 75353494
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
JLExeter:vfu_B00370  12 EGKQKAFDEACCAFRAAN--KVSAIAAAVGLDATVLRNKLNPEQPHVLTCAELVAITKASGDYTIINSLLLGLGVVTAQL 89  Vibrio f...
CBJ80127              6 VSKQSYFDNACRAFSNAHsgDLVQIAESIGMTPQILRNKLNPEQPHMLTCVDLMKLTDATEDASILDGLLEQLQCQPSVP 85  Xenorhab...
CAX58611              6 VSKHPHFDDACRAFAQRH--NLADVAVEATMNVQMLRNKLNPDQKHQLTCADLMRLTDVTEDASLLDALLAQMHCLPSVP 83  Erwinia ...
WP_022548582          6 TSTHNQYDDACRKFALTH--SMAELAQRAGMKAQTLRNKLNPDQVNQLTVPELLLLTDLTEDATLIDGALAQLHCLPCVP 83  Plautia ...
wugsc:KPN_04891       6 VSKHPHYDEACRAFAQRH--NMAKLAERAGMNVQTLRNKLNPEQPHQFTPPELWLLTDLTEDSTLVDGFLAQIHCLPCVP 83  Klebsiel...
Q8ZMR7                6 ISKHPHFDEACRVFALRH--NMAKLAERAGMKVQTLRNKLNPEQPHQLTPSEIWLLTDLTEDSTLVDGFLAQIHCLPCVP 83  Salmonel...
IEC:ABF-0017281       6 IAKQTHFDEACRAFSLCH--NLAELARTAGMNQQILRNKLNPDQPHKLTCEELLTLTDITEDATLIDGLLAQLNCLPAVP 83  Dickeya ...
WP_014292224         10 gTEFPHWESAVARFKAAH--NQSEVARSIGTQPQLWINKLSPEQSGEPTVKNVIAAARVTGDCTLVHGLLLELDMAGIAL 87  Oceanimo...
Q5E365               12 GAAQSNYDDACVAFSAAN--KCAPIERETGVKK--LADKLNPEQPHKLSVMDVKLITKASGDYTIVNSLLYSLDMVAVAV 87  Aliivibr...
WP_014205490         12 SAKQNAFDEACCAFATNH--NMASLARKMDMGETMLRNKLNPEQPHKLYAIELAWLCHHSGDYSIHNVLYSDLGTVTVAL 89  Vibrio
JLExeter:vfu_B00370  90 PQ---EEKTETFLKRVLEHSMLSGDLSRMALDhggDTRLPRTTRHKIISKAQASIGNLMLLISDLENRTSgATPFFAMSV 166 Vibrio f...
CBJ80127             86 VN---EVCDANMPSYLLGATAEVGKLASEAVS---GEHLNQTRVAEFKKTVNNAVRLLTLAGVTMSSRLY-SNPAFNTTV 158 Xenorhab...
CAX58611             84 VN---EMTADKLDIYALKATAEVGQLAAYAVS---GGRMTAGGRSALVTSINAGVRYLSLAALAVQSRIH-SNPTLSSTV 156 Erwinia ...
WP_022548582         84 VN---ELAKEKFQSYVLKATTEIGSMAASAAN---PERITATCRRSILEVANNGIRCMMLAALAVQTRVH-SNPTLASTV 156 Plautia ...
wugsc:KPN_04891      84 VN---ELAKDKLQSYVMRAMSELGELASGAVS---NERLTSARKHNMIESVNAGIRMLSLSALALHARLQ-ANPAMTSVV 156 Klebsiel...
Q8ZMR7               84 MN---EVAKEKLPHYVMSATAEIGRIAAGAVS---GDVKTTAGRRDVISSINSVTRLMALAAVSIQARLQ-ANPAMASAV 156 Salmonel...
IEC:ABF-0017281      84 VN---EARTERLTAYVLQATAAVGKVAAESVS---DERMTQTRRHSLISTISDGVRYLSLIGLTVQSRIQ-ANPAMASTL 156 Dickeya ...
WP_014292224         88 PKsnhQGDEQPLTSQALEITATAGELARDAISaqqAGRVCQQRRDNAVSKATAMMGALALFVHNVESRFH-AIPGMTVAF 166 Oceanimo...
Q5E365               88 DK---NGESETFVKRTLDNSIYAGELAQEALKhagQKRMTGRSKNTIVKKAHTAIGNLVLLINDMEGRTPnASSFLSMGM 164 Aliivibr...
WP_014205490         90 PP---ESEQKSFIERTLMNNALSGELSGDAMQmctAERLPRSTKNRTLAKAHAALGNLVLMISDLENRTTgVTPMLSMGM 166 Vibrio
JLExeter:vfu_B00370 167 DFIT 170 Vibrio furnissii NCTC 11218
CBJ80127            159 DVVA 162 Xenorhabdus bovienii SS-2004
CAX58611            157 DAVS 160 Erwinia billingiae Eb661
WP_022548582        157 DAIS 160 Plautia stali symbiont
wugsc:KPN_04891     157 DTMS 160 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Q8ZMR7              157 DTVT 160 Salmonella enterica subsp. enterica serovar Typhimurium
IEC:ABF-0017281     157 DALS 160 Dickeya dadantii 3937
WP_014292224        167 DTLT 170 Oceanimonas sp. GK1
Q5E365              165 DLLS 168 Aliivibrio fischeri ES114
WP_014205490        167 DFLV 170 Vibrio
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap