Conserved Protein Domain Family
Phage_Mu_Gp45

?
pfam06890: Phage_Mu_Gp45 
Bacteriophage Mu Gp45 protein
This family consists of Bacteriophage Mu Gp45 related proteins from both phages and bacteria. The function of this family is unknown although it has been suggested that family members may be involved in baseplate assembly.
Statistics
?
PSSM-Id: 399700
Aligned: 76 rows
Threshold Bit Score: 57.5222
Threshold Setting Gi: 689730515
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_008852276   17 RGVVQEVNDTGPVQTVTVQVHYGQTRSRVLVHQPFGFSSSpPLDGAVTHVVQNG-ADPSDLFALPPANPS 85   Gluconobacter morbifer
OCX13129       15 RSVLKNVRDDGETQRCSVEVADGIWRDDVEILQPFGFASSvPEDGALAIVLSVG-SDEGDLVVLPVANPS 83   Mesorhizobium sp. UASWS...
WP_076435690   16 RGVVRSTNDKGAMQTASVTTHRHVDRTDVEVVQPFGFASR-PPAGGLMIVLAIG-GDQGDLAGLPVAAPG 83   Bosea sp. TND4EK4
WP_012116455   15 RATVSTVDDTGETQTATLQGRAGAEMTEVEILQPFGFAST-PPDGGLVIVLAVG-GDQGDPVALPIAAPG 82   Xanthobacter autotrophicus
WP_043240970   13 RGKVAKVDDSGDGQLIDFKGYTGESFSKVLRAQPHGLSSH-PP--ADAVGIFLRhGSSDRLTAIGFETSG 79   Bosea sp. LC85
KQP11151        8 RAQITETNDDGEMQLGRGQGYAGEEVDKVHIVRQHGLASH-APKNSHGIGIAGS-GERGLVAFLGMEHQD 75   Methylobacterium sp. Le...
WP_092496164   35 RFQVSETQDDGAMQTLKGLGYASEELTGVHRVMPFGLASF-APAGSHALAVAMR-GQRSLVAALGLEHPD 102  bacterium A52C2
WP_068678500   21 RGRITTGNDAGMVQTQQVKIGEVEVRDNTKRVAEYGFTSM-PLPGCHAVVIFVG-GDRSNGVIVATNDQN 88   unclassified Variovorax
KEH15722      797 RGRITFVDDAGPVQIVQLRMNGLEVPAGRYRVPEFGFSSN-PPIGSDALALHVA-GDRSAGAVVGTNHQE 864  barrel medic
SIT43658       18 RGILQLVADGGDVQRMQVKFSPLETTDNIPRCAEYGFVSN-PPDGSDAVVIFGA-GDRSNGVVIATGNAT 85   Paraburkholderia piptad...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap