Conserved Protein Domain Family
DUF1264

?
pfam06884: DUF1264 
Protein of unknown function (DUF1264)
This family contains a number of bacterial and eukaryotic proteins of unknown function that are approximately 200 residues long. Some family members are annotated as putative lipoproteins.
Statistics
?
PSSM-Id: 399697
View PSSM: pfam06884
Aligned: 105 rows
Threshold Bit Score: 229.3
Threshold Setting Gi: 757948048
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCF53378         5 FAPVDKIHQALHAYHVVADERGEIVPSVHYCSCnSSGDHFQCLIYESDEPDAKLIGVEYMVSEDVFLQLPEDEKKYWHSH 84  Ustilago hordei
WP_009155064    35 TAPLNGFDVYVVGFHCARNEPETQMEAHHYCRV-VNEDLLQCVLFDGNTRQANLIGVEYIVSERLFDTLPRQEQDRWHPH 113 Saccharomonos...
jgi:Hoch_0442   71 NSPTDKLDVYVVGFHPMKNDPGHQMEAHHFCRQ-VNEDFAQCALYDSGEADANLNGIEYIISEKLYETLPEGEKPYWHPH 149 Haliangium oc...
Q8P969          42 nGPVGKLDIYLVGFHPMKDAPEQQMEAHHYCQQ-VNQDLAQCALYDGNTAEANLTGIEYIISESLFAQLPAQERAFWHPH 120 Xanthomonas c...
jgi:Psesu_2097  52 nGPLGKMDMYVVGFHPMKDHPLHQMEAHHFCRQ-VNEDFAQCTLFDGNSPEANLTGIEYIISESLYESLADDEKQYWHPH 130 Pseudoxanthom...
Q3J732          53 dAPPDKLNIYLVGFHPLKNDPQHQFEAHHFCQQ-VNQDFAQCVLYDGNTPDANMNGIEYIISERLFNSLPEKEQQYWHPH 131 Nitrosococcus...
Q3SGN4          52 ESPLKPMHVHLSGFHAMKNDPAHQMAAEHYCSQ-VNEDFAQCALFDGNTRSANLTGIEYIISEKLFKQLPAQERQYWHPH 130 Thiobacillus ...
Q2Y943          63 gSPLKPFGIYLVGFHPMKDSPEDQMEAHHYCHQ-VNEDFAQCTLFDGNTEDANLNGIEFIISAKLFNTLPEEEKKYWHPH 141 Nitrosospira ...
EEF24567        56 NSPVGGFDIYLVGFHPMKDHPDQQMEAHHYCHQ-VNEDFAQCILFDGNTRTANMNGTEYIISEKLFNTLPPEERPFWHPH 134 castor bean
Q5P1R6          57 nSPLAPMDIHLSGFHPLKDDPEHQMEAHHFCHQ-VNEDFAQCVLFDGNETGANLNGVEYIISAKLFETLPDDEKPLWHPH 135 Aromatoleum a...
CCF53378        85 VHEVMGGSLVLiglragmvaeaaaaaaksaedavKavagagatGgaVPDAAELAALARIKKLYGKAIHLWHPT------S 158 Ustilago hordei
WP_009155064   114 NYEILSGQLAA-----------------------P--------G--LPEVAERAFLKRLLNSYGKTWHTWHTGrhdgepG 160 Saccharomonos...
jgi:Hoch_0442  150 NYEILSGQLIA-----------------------P--------G--LPEVAETELMKGKMNSYGKTWHTWFTGgga-hdG 195 Haliangium oc...
Q8P969         121 NGEILSGQLSA-----------------------P--------N--LPLVAEKELMRSKMNSYGKTWHTWHSRkgt-apG 166 Xanthomonas c...
jgi:Psesu_2097 131 NGEILSGQLVA-----------------------P--------N--LPEVAEKELMRSKMNTYGKTWHTWHTRdgv-npG 176 Pseudoxanthom...
Q3J732         132 NGEILSGQLVA-----------------------P--------G--LPEAADKEVMQGKMNSYGKTWHTWRVThgn-gnN 177 Nitrosococcus...
Q3SGN4         131 NYEILSGQLVA-----------------------P--------G--LPDVAEKALMKGKMNSYGKTWHVWNTGdat-kkG 176 Thiobacillus ...
Q2Y943         142 NGEILSGQLVA-----------------------P--------N--IPDIAEKELMKGKMNSYGKTWHVWNTGyeg-klG 187 Nitrosospira ...
EEF24567       135 NGEILSGQLMA-----------------------P--------G--IPDVAEHALMKTKMNSYGKTWHVWDTE------R 175 castor bean
Q5P1R6         136 NGEILSGQLMA-----------------------P--------G--IPEAAEKALMKGKMNSYGKTWHVWNTGths-gaG 181 Aromatoleum a...
CCF53378       159 SAVPMGPPKLMMPIDEKydGVPd-KMIKQRDERYAIDTERKKAERQD 204 Ustilago hordei
WP_009155064   161 DGLPLGEPKLMWSFNRD--GECdeSLRRDRDEAMGLDTARNRQRRRE 205 Saccharomonospora marina
jgi:Hoch_0442  196 QKLPLGEPQLAWSINAD--GEVdpALVEKRDHSLDVSTEDTRAERQA 240 Haliangium ochraceum DSM 14365
Q8P969         167 DTLPLGEPMLAWSFSRD--GEIqqPLIEQRDKAVTISTAERRADRKD 211 Xanthomonas campestris pv. campestris
jgi:Psesu_2097 177 HKMPVGPAMLAWSFSRD--GEVqpELVAERDKRMDISTEERRRDRED 221 Pseudoxanthomonas suwonensis 11-1
Q3J732         178 DQLPLGEPALAWSFNRF--GEAkpGLVESRDRRMDINTEERRRQRQD 222 Nitrosococcus oceani ATCC 19707
Q3SGN4         177 DPLPYGDPALAWSFNRD--GEAdaGMVQRRDRALEIDPVKKRRGRAD 221 Thiobacillus denitrificans ATCC 25259
Q2Y943         188 DALPLGQPMLGWSFNHE--GEAvpGLVEKRDKNMKIDSEEKRRQRAD 232 Nitrosospira multiformis ATCC 25196
EEF24567       176 NNLPLGPAMLAWSFNRD--GEAapGLVEQRDRKMERDTAKTRAARRD 220 castor bean
Q5P1R6         182 DSLPLGPPRLAWSFNRD--GEAqpGLVEQRDRRLEVDSAAKRRERAE 226 Aromatoleum aromaticum EbN1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap