Conserved Protein Domain Family

pfam06880: DUF1262 
Protein of unknown function (DUF1262)
This family represents a conserved region within a number of proteins of unknown function that seem to be specific to Arabidopsis thaliana. Note that some family members contain more than one copy of this region.
PSSM-Id: 399693
Aligned: 32 rows
Threshold Bit Score: 113.109
Threshold Setting Gi: 550309290
Created: 21-May-2020
Updated: 7-Aug-2020
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
XP_009391265  93 QPLSTNRYYVITAKGKHKGKAYTCS-KEEDMTSCCV 127 wild Malaysian banana
EFH69015      89 QPPSSNLYYVIRRRGKHAGEACVSA-KEGDRVSCCL 123 Arabidopsis lyrata subsp. lyrata
XP_002892752  95 QPVSSNRYYAIKGSGKHSGEASANA-KEEDRVPCCF 129 Arabidopsis lyrata subsp. lyrata
XP_002892755  89 QPLSSNLYYVIQRRGKHTGKASASA-KEEERVSSCF 123 Arabidopsis lyrata subsp. lyrata
XP_002892757  90 KPLSSNCYYAIKRHGKHSGEASGSA-KEEDKVSCCF 124 Arabidopsis lyrata subsp. lyrata
XP_020866964  89 QPYYSNRYYVIKRRGKQSGGASASA-KEEDRVPCCF 123 Arabidopsis lyrata subsp. lyrata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap