Conserved Protein Domain Family
PRF

?
pfam06875: PRF 
Plethodontid receptivity factor PRF
This family consists of several plethodontid receptivity factor (PRF) proteins which seem to be specific to Plethodon jordani (Jordan's salamander). PRF is a courtship pheromone produced by males increase female receptivity.
Statistics
?
PSSM-Id: 115526
View PSSM: pfam06875
Aligned: 2 rows
Threshold Bit Score: 384.868
Threshold Setting Gi: 82124696
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5BNQ4   2 RSTSLLTFLVVSLSTATSLAMAEINDVADLSSDTIVLFSEVQKFAEDIQSSADSLLPTYLSFQGAPLSDPDYQLPHIKVV 81  Plethodon shermani x ...
Q5BNQ2   2 RSTSLLTFLVVSLSTATSLAMAEINDVADLSSDTIVRFSEVQKFAEDIQSSADSLLPTYLSFQGAPLSDPDYQLPHIKVA 81  Plethodon shermani x ...
Q5BNQ4  82 NLPTAAMDYDTFIRQTDETRLKNNLYFYSAIVEFLKEAMTEQEDLNPAELALKAKFEEAMANSNTLISKISDIMTQMGMS 161 Plethodon shermani x ...
Q5BNQ2  82 NLPTAAMDYDTFMKQTDETRLNNNLYFYSAIVEFLKEAMTEQEDLNPAELSLKAKFEEAMANSNTLISKISDIMTQMGMS 161 Plethodon shermani x ...
Q5BNQ4 162 VTITLPKPLVVPFKGSAYFSKKLRGGVVCKEYKERVFLTKRDFMLLAEKYQGPL 215 Plethodon shermani x Plethodon teyahalee
Q5BNQ2 162 VTITLPKPLVVPFEGSAYFRKKLRGGVVCKEYKERVLLTKRDFEFLAKKYQGHL 215 Plethodon shermani x Plethodon teyahalee
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap