Conserved Protein Domain Family
FBPase_2

?
pfam06874: FBPase_2 
Firmicute fructose-1,6-bisphosphatase
This family consists of several bacterial fructose-1,6-bisphosphatase proteins (EC:3.1.3.11) which seem to be specific to phylum Firmicutes. Fructose-1,6-bisphosphatase (FBPase) is a well known enzyme involved in gluconeogenesis. This family does not seem to be structurally related to pfam00316.
Statistics
?
PSSM-Id: 399690
Aligned: 124 rows
Threshold Bit Score: 861.367
Threshold Setting Gi: 430015107
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jcvi:HMPREF9243_0316   7 FLQLLAEKFPNKAAASTEMINLEAIMSLPKGTEHFMTDLHGEFDAVNHVLRNGSGNIKEKINEIFGDrLSTKRRAELATI 86  Aerococ...
jgi:Olsu_1042         44 YLTLLSRNFPTSQSVFTEIINLEAILNLPKGTEHFMSDVHGEYEAFVHILNNCSGVIRERVSAMFQGeLSAAEQADLCTL 123 Olsenel...
CCZ91276              10 YLKLLSEKYPAKEAVIREIINLSAILNLPKGTEHFMSDIHGEYEAFCHILNNCSGVIREKVMRYFGEeFTKEQCQELCTL 89  Clostri...
CDD34968               8 YLKILAEKYQSVQAVCREIINLNAILNLPKGTEHFMSDLHGEYEAFCHILNNCSGVIREKVDLLFEEqLNDSERQAICTL 87  Rosebur...
WP_012740745           7 YLKLLKEKYPTKQSVYRELINLNAIMNLPKGTEHFMSDLHGEYDAFYHIINNCSGVIREKVAMLYGDeLTVYEQQELCTL 86  Lachnos...
CDD73174              13 YLKLLKQNYSSSQAVIREIVNLTAITNLPKGTEFFLSDIHGEYEAFLHIMNNCSGVIKEKVDLIFKDtLSEFDRQELCTL 92  Clostri...
CDA29524               6 YLQLLSEKYPTIQSVCTEIINLNAILNLPKGTEHFMSDLHGEYEAFCHLLNNCAGEVRDKVDRMFSDiMTKEERKEICTL 85  Eubacte...
CCX49800               8 LLQQMAREYPTVQAASAEIINLTAILNLPKGTEHFMSDIHGEHEAFLHILNNGSGAVAEKIQSALGDsLTLSERRSLAAL 87  Clostri...
jgi:Shel_17320         8 TLEHLSETYPTAQAARAEAEASARQLADLKGAVVFASDVHGEYNAFDHILRSGCGSIRQTIDSLFADeLTEEERAELATL 87  Slackia...
A9FZA0                 9 lLRALAGRYPTTEAALSEIGHLRAILSLPKGTVHVVSDVHGEHRKLKHIINNASGSLRPLVERVFGDrLTAAEERALLSA 88  Sorangi...
jcvi:HMPREF9243_0316  87 IYYPEEKLRAlTKEMDSqaeIDEFYTLT--TSRLVELTQFVVSKYTRSKVHKAMNPDMAYIMDELIFK-DSILSNKEHYY 163 Aerococ...
jgi:Olsu_1042        124 IYYPHEKLRRaHDSGLA---SEAWYAEN--LMRLVRIARLLSGLYTRSKVRKAMPVAYAYIIDELLHAsGAGETSRHEYH 198 Olsenel...
CCZ91276              90 IYYPREKMDMlKSAGKL---TEEWYREN--LNRLIELAKRMSSKYTRSKVRKAMPGDFSYIIDELLHVqKDEDDNQVLYH 164 Clostri...
CDD34968              88 IYYPKEKLEQlKKENAL---STERYRMI--LNQLIEIAKLLSSKYTRSKVRKAMPEDFAYIIDELLHVqKDEDDNQVRYH 162 Rosebur...
WP_012740745          87 IYYPREKLSIlMDENKV---NDEWYRNV--LNQLIQIAKLLSSKYTRSKVRKAMPVDFAYIIDELIHAqKDEDDNRSVYH 161 Lachnos...
CDD73174              93 IYYPREKMTLlGETNRI---DGNWYAMT--LNHLIMVAKLLSSKYTRSKVRKALPEDYAYIIDELLHAqEDEDANQIRYH 167 Clostri...
CDA29524              86 IYYPKEKMNLlRQEDKL---TDGWYRDN--LKKLINIAKKFSSKYTRSKVRKAMPQDYRYIIDELLHMqEDEDNNQIVYH 160 Eubacte...
CCX49800              88 IYYPKEKLREvKRAETD---MEDWYRVT--LKRLISVCRQCTTKYSRSKVRKALPREYAYIMEEML-N-TGGTPNKERYY 160 Clostri...
jgi:Shel_17320        88 VYYPREKAELlLSQPED---QTTWLGKV--LPQLAAVLQAVAEGRPEA-LRREMPEGAADTIGALLAG------DAEP-- 153 Slackia...
A9FZA0                89 VYYPRERYARv-ASHSE---GARWAFLIwtLAREVEVIRALSLRYTLRQVEAAFPEDMRGLLRELVSArATL--GEGGYL 162 Sorangi...
jcvi:HMPREF9243_0316 164 KRIIQSVIDLDEAPRLITCLAELIRELVVDHLHILGDIYDRGPAPDQILDLLMEKNSLDIEWGNHDMIWMGAASGSKALI 243 Aerococ...
jgi:Olsu_1042        199 VQILYSIIGTGSADDFICSLASLIKRLAVDRLHIVGDVFDRGPHADRIIDRLMGYHSLDIQWGNHDICWMGAAAGSEACI 278 Olsenel...
CCZ91276             165 QKILDTIIEVESADGFIMSLAELIKRLAVDHLHIVGDIFDRGPYPHKIMELLINHHSLDIEWGNHDILWMGAACGNGACI 244 Clostri...
CDD34968             163 QKILDTILEIDNADEFIVALAELIKRLAVDHLHIVGDIFDRGPYADKIMDLLMNYHSLDFEWGNHDILWMGAAAGNQACI 242 Rosebur...
WP_012740745         162 RQIMETILSLHNGDEFLVALTDLIKRLAVDHLHILGDIYDRGPHADKILDLLMEHHSVDIQWGNHDILWMGAFCGNPVCM 241 Lachnos...
CDD73174             168 KQILQTIIELEDADEFIIALSQLIKRLAVDHLHIVGDIFDRGGSADKILDLLYDYHSLDIEWGNHDILWMGAACGNDACI 247 Clostri...
CDA29524             161 EKILDTIISIKNAEEFIEALSTLIKRLAVDHLHIVGDVFDRGEHPDDILDLLMEHHSIDIQWGNHDILWMGATAGSDACI 240 Eubacte...
CCX49800             161 DHIIRAIVDTGSADTMIEEMATLIKRMTVDELHIVGDIFDRGPHADVILDHLMTHHHVDVQWGNHDVLWMGAAAGSPACV 240 Clostri...
jgi:Shel_17320       154 ------ALRAGDPAGIVEAVGTLIQRLSISHLHMVGDVYDRGPSPELIMDMMMGYHSIDIQWGNHDVLWMGAALGQRGCV 227 Slackia...
A9FZA0               163 DALLDPFVQHGREIEILRATARAIRNLTVFELVVAGDLGDRGPRLDKVIEYLMRQPRVRVVWGNHDVSWMGASLGQEALI 242 Sorangi...
jcvi:HMPREF9243_0316 244 ANVVRIQARYDNLSVIEHAYGIPLRPLVNLADTVYKDADLTGFMPKLAEDHDYHHDEVEQLARMQLAMAIIQFKLEAQVI 323 Aerococ...
jgi:Olsu_1042        279 ASVVRTNVRYGTLDMLESAYGISLRELALFAGRSY--------------------RADDEISAMEKAIDVMLFKLEGQLI 338 Olsenel...
CCZ91276             245 ANAIRNNLRHNNTEVLESGYGISMRSLTLFAENMY--------------------DKQDPMEAAAKAISVIMLKLEGQLI 304 Clostri...
CDD34968             243 ANVLKNNLRHHNTEILESGYGISLRELALFAEKTY--------------------ANVEPMEAADKAVSVMLLKLEGQTI 302 Rosebur...
WP_012740745         242 ALVVRNNIKYKTMSILENGYGISLRFLLQFAVNTY--------------------SDKNVDDAVYKAISVILFKLEGQLI 301 Lachnos...
CDD73174             248 CSVIRNNLKYDNVEILENAYGISLRQLILFGMKTY--------------------GIEDGIKAALAAVTVILFKLEGQLI 307 Clostri...
CDA29524             241 ATTIRNNIQYNNMQMLENGYGISLRTLTLFAERLY--------------------PDMEPMKAALKAISVILFKLEGQII 300 Eubacte...
CCX49800             241 ATAVKNCVQYDNLDMLENAYGINLLPLAVFSTERYG--DARVFAPRKLPEEPFKPRDTELYSRMHKAISVIMYKLEGQLV 318 Clostri...
jgi:Shel_17320       228 ANVVRICARYGNFPILEDSYGISMKPLVDFALETYKDDPCVGFAPKIKGD--FTPEELARWSKIQKAIAYIQFKVEAKLI 305 Slackia...
A9FZA0               243 ATVVRLSLRYGRLSQLEEGFGISVAPLDRLARTAYADDPAERFAVRGEGL-----RDALLMARMQKAAAVLQFKLEGQLC 317 Sorangi...
jcvi:HMPREF9243_0316 324 RRHPEFGCDNRLLLDKIDYHAGTINWQGKTYPLVNTSFPTVDPKDPYALTEEEGAVMEALQAAFLDSERLQKHVAFLINK 403 Aerococ...
jgi:Olsu_1042        339 VRHPEFQMEDRLLLDKIDLQDASVTIDGRRCELKTCDFPTVDPERPYELTDGERRVLDGLVTAFHESDRLRRHVSFLYEK 418 Olsenel...
CCZ91276             305 KAHPEYGMNDRLLLDKMDVKTGHVIWEGIKYSLNDNDFPTVDPKDPYTLTEEEKAVMKELRAAFLNSAQLQKHVKFLYEK 384 Clostri...
CDD34968             303 QRHPEYGMNDRLLLSKIDKETKTVEINGKEYPLKDGDFPTLQGEDVYALTEEEAHVMDELTTAFMNSDRLQRHISYLYEK 382 Rosebur...
WP_012740745         302 KRHPEYRMEGRLLLDKMNLDKGTVRIGDKEYFLNTTEFPTIDMNNPYELTMEEMFLMGRFRADFINSMALERHINFLYEK 381 Lachnos...
CDD73174             308 KAHPEYEMSDRLLLGQMDDTKNKVMTEGEWVTMNTNVFPTVDLADPYELTEEETEILRKLHRNFVSSQRLQKHIRFLYEK 387 Clostri...
CDA29524             301 SRHPEYNMDDRRLLHKINYENGTIEIEGKTYEMNDVNFPTVDRKNPYELSSEEKQLVKELRRMYVNNKRLKQHIEFLYAK 380 Eubacte...
CCX49800             319 HRRREYGMEDRDMMSRVNWGAGTINIDGTDYPLRDTDFPTVYPNDPTKLSEEEAALMEQLCAAFMHSEKLQAHARFLCSA 398 Clostri...
jgi:Shel_17320       306 AENPSFGLDDRNLLHLIDRERGTVVVDGVEYEVQDMVFPTVDWDDPYRLSDEESAVMDYLEQAFMNCEKLQRHIRFFLDA 385 Slackia...
A9FZA0               318 RRRPEYALEHRCLLHRIDARAGTVAIDGEVFPLLDARFPTLDPGDPYALTPDEAACVALLKESFLRSPALSRQMRWMVQQ 397 Sorangi...
jcvi:HMPREF9243_0316 404 GSMYKIYNNNLMFHGCIPMNEDGTFMAATIDGET-LAGQVLLDKFDQVVRRMYAQRqsDESKNPDLDFAWYLWQGEGSAL 482 Aerococ...
jgi:Olsu_1042        419 GTLYLVWNNVLLFHGCLPLDADGSFSAIEAAGGS-ISGRAYMDFCDRIARRAW-----HEGDQEALDWMWYLWCGRHSPL 492 Olsenel...
CCZ91276             385 GSMYRVFNGNLLYHGCIPFDAHGKFDRMEFDGKV-YQGKAYLDYADSMAREAF-----LKKTPEAVDFMWFLWSGRKSPL 458 Clostri...
CDD34968             383 GSMYRIFNGNLLYHGCVPLDESGNFDGVRFGDEI-YQGKRYLDYADKMARRAYF----HRKDQDALDFMWFLWCGRKSPL 457 Rosebur...
WP_012740745         382 GSIYKIHNGNLLFHGCVPLDEQGVFDGIVVDCKS-YSGREYLDYCESMVRQA------RTRDSDAVDFMWFLWSNILSPV 454 Lachnos...
CDD73174             388 GSMYNVYNGNLIYHGCVPVDKNGAFDKLCIDGKY-YHGKALLDKCEEKARAAYL----DNPDKDDIDFMWFLWGGEKSPL 462 Clostri...
CDA29524             381 GSMYCCFNNNLLYHGCVPLDEDGNFAVIKLNDKN-YKGKDYLDYADKMARKAYF----NKNNQDELDFMWYLWCGEKSPL 455 Eubacte...
CCX49800             399 GSLYLKRNGNLLFHGCVPCNRDGSFMEFEVGKAVtLSGKAYFDYADRLARQGLLAPegSEEREEGRDYLWYLWCGRNSPV 478 Clostri...
jgi:Shel_17320       386 GSFYKICGDFLLYHACVPLNADGSLKEVTVLGET-YKGRSLFDAMERYTRQAFDDPd-PAKRKVGRDMIWYMWLGQGSPL 463 Slackia...
A9FZA0               398 GTTWLRRDRALIFHGCVPVDGEGELLPFVVDGEV-RRGRALFDALERTVRRAF-----RAGAQEDVDMLWYLWTGPLSPM 471 Sorangi...
jcvi:HMPREF9243_0316 483 FGKKQMATFERYFIAD------KETHQEHRNVYYSWREDIDFVRRVLEEFGIDPDKGHIINGHTPIKAKDGEDAIKADGK 556 Aerococ...
jgi:Olsu_1042        493 SGR-VVKTFERSFVED------ESTWVEPEDPYYRLTRSPAVCEDVLEEFGLDASGAHIVNGHVPVKAKAGESPLRADGR 565 Olsenel...
CCZ91276             459 CGR-NIRTFERMFLDD------ERTWREESNPYYKFYHQEEVCNMILGEFGLHSETSHIVNGHTPVKTMEGEQPIRANGK 531 Clostri...
CDD34968             458 CGR-NIKTFERMFVTD------ESAWVEESNPYYRYHEEERTCNMILREFGLYSEHSHIINGHTPVKTMEGEQPIRAGGK 530 Rosebur...
WP_012740745         455 TGR-CIKTFERTFLDKdrnadyKNAIKEDKNPYYDLYENERICKMILREFNLYNESAHIINGHTPVRTKEGQHPVRANGK 533 Lachnos...
CDD73174             463 CGR-KLKTFEREYVDE------ESLWTEESNPYYSKYYDESFCCQILHEFGLYDDDSHIINGHTPVHAIEGENPVRAKGR 535 Clostri...
CDA29524             456 SGR-RIKTFERTFIDD------KNAWNEPKNPYYDFYKDEKTCNMILHDFDMYSPMSHIINGHTPIRVTKGEKPVHANGK 528 Eubacte...
CCX49800             479 FGRDHIATFERALIED------KATWKEPKNHYYSYTDEEEFCRKILHSFGCDKPWSRIVNGHVPVKAKEGESPLKGHGR 552 Clostri...
jgi:Shel_17320       464 FAKSKMATFEIYMIAD------KAARKEVKNPYYSLLEDEQVLAGIFEDFGMDPAVSRIVSGHVPVKVKDGEDPVKCGGK 537 Slackia...
A9FZA0               472 FGKDRMTTFESYFVAD------ERTHRETKNPYFHLIHDAAFCGRVCREFGVDEERGLIVNGHVPVRVERGESPIKASRR 545 Sorangi...
jcvi:HMPREF9243_0316 557 MIVIDGGFAKAYQKTTGLGGFTLLYNSYGMQLVAHHPFHGKEDAIKYETDIESTRRVVDKElERISVRETDIGKQLTCQV 636 Aerococ...
jgi:Olsu_1042        566 LMVIDGGFCQAYHKKTGIAGYTLTAASDGMRIKAHRPFQSVEAALDDNVDIESSTTVIEREeVPLKIRDTDTGREIRAQI 645 Olsenel...
CCZ91276             532 LMVIDGGFCKDYHEKTGIAGYTLIYNSHGVRIKAHHPFESVYKALRENKDIDSESMIVDTEeNRILVKETDNGRRIQEQI 611 Clostri...
CDD34968             531 LLVIDGGFCKDYHKTTGIAGYTLIYNSHGMRIKAHHPFESVKKALQENKDIASESQIVETEkTRVLVKDTDVGKKIMAYI 610 Rosebur...
WP_012740745         534 LIVIDGGFCEGYHAATGIAGYTLIYNSHGMKIKEHHPFMSINMAINSNRDIESESQVVYVEkKRVFVKDTDNGKQITEEI 613 Lachnos...
CDD73174             536 LFVIDGGFCRSMNKATGIAGYTLIFNSHGLRLKAHTPFTSVEDALMNNTDIESSSEIIEKDlQRMFVKDTDIGKHLLEEI 615 Clostri...
CDA29524             529 LIIIDGGFCKAYHDTTGIAGYTLIYNSHSMRLMSHQPFESIETALEENKDIESTADRIETIdKRVMVRDSDIGKNIKKQI 608 Eubacte...
CCX49800             553 LVVIDGGFCRAYQSQTGIAGYTMFFNSLGMRLAAHEPFTSIEDAVKNGRDITSHTFNVDELsHRVMVADIDTGEEIQSRI 632 Clostri...
jgi:Shel_17320       538 AMIIDGGFSRAYQSATGIAGFALVNDANGLRLGYLEPLESQQAAIERNLDIVPKWRTLAENeSPLHVGDTEYGLVLRDKI 617 Slackia...
A9FZA0               546 AVTIDGAFSEAY----GDKGYTLVLEASGARLAQHHHFTSVEQAVEAGEDIIPVISDVEVYeAERRVGDTEKGEEIEREI 621 Sorangi...
jcvi:HMPREF9243_0316 637 QALKALIEAYQA 648 Aerococcus urinae ACS-120-V-Col10a
jgi:Olsu_1042        646 ADLRRLLHAYRT 657 Olsenella uli DSM 7084
CCZ91276             612 DDLKQLKQWYer 623 Clostridium sp. CAG:167
CDD34968             611 SDLEELMQQYRN 622 Roseburia sp. CAG:309
WP_012740745         614 NDLMNLLKLYNt 625 Lachnospira eligens
CDD73174             616 SDLRKLLENYRr 627 Clostridium sp. CAG:62
CDA29524             609 KELEELLEGYRQ 620 Eubacterium sp. CAG:156
CCX49800             633 DDLMKLLEAFRD 644 Clostridium sp. CAG:226
jgi:Shel_17320       618 DALTRLAEAYEA 629 Slackia heliotrinireducens DSM 20476
A9FZA0               622 ELLERLIEAYRD 633 Sorangium cellulosum So ce56
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap