4FMA


Conserved Protein Domain Family
EspG

?
pfam06872: EspG 
Click on image for an interactive view with Cn3D
EspG protein
This family consists of several EspG like proteins from Citrobacter rodentium and Escherichia coli. EspG is secreted by the type III secretory system and is translocated into host epithelial cells. EspG is homologous with Shigella flexneri protein VirA and can rescue invasion in a Shigella virA mutant, indicating that these proteins are functionally equivalent in Shigella. EspG plays an accessory but as yet undefined role in EPEC virulence that may involve intestinal colonisation.
Statistics
?
PSSM-Id: 399689
View PSSM: pfam06872
Aligned: 4 rows
Threshold Bit Score: 473.601
Threshold Setting Gi: 281603938
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4FMA_B               1 EMSCAEKLLKVLSFGLWNPTYSRSERQSFQELLTVLEPVYPLPNELGRVSARFSDGSSLRISVTNSESIEAEIRTPDNEK 80  Escherich...
CBG89704            47 EMTCAEKLLKILTLGLWNPKYSQDERQQFQGLLTVLEPVSPAHNELGRVYAKFSDGSSLRISVTNSELIEAEIHTPNNEK 126 Citrobact...
ChinaCDC:SFxv_5026  30 KLSFCDILLKIITFGIYSPHETLAEKHSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKG---ICSVFYLDGDK 106 Shigella ...
CAS10464            41 DKPWAERILSYLGLSHCRSEYKGDDRL-LLDVLSILKPILPSSNEAGKVQASFSDGSRLTISVTKSELIEIAVTTPEGDE 119 Escherich...
4FMA_B              81 I-TVLLESNEQNRLLQSL-PIDRHMPYIQVHRALSEMDLTDTTSMRNLLGFTSKLSTTLIPHNAQTDPLSGPTPFSSIFM 158 Escherich...
CBG89704           127 F-LVLLEANEQNRLLQSL-PINRHMPYIQVHHTLPQEELTDLLSMHKLLSFTSKLSATLIPHNNQTDPLSGLTPFSTVFM 204 Citrobact...
ChinaCDC:SFxv_5026 107 IqSTQLSSKEYNNLLSSLpPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFH--VKDTDFNSVWH 184 Shigella ...
CAS10464           120 V-SIFPERNKQDCLLKSL-PVALHMPYIKKHHSLPEIEVNGADGMRFLCNFAAKLSTAIVPYSEKTNPLSGVSPLNSIYA 197 Escherich...
4FMA_B             159 DTCRGL-----GNAKLSLNGVDIPANAQMLLRDALGLKDTHSSPSRNVIDHGISRHDAEQIARESSGSDN-----QKAEV 228 Escherich...
CBG89704           205 DTSRGL-----GNSKLSLNGVDIPADAQKLLRNTLGLKDTNSSPDLNVIRNGIPRHYAEQIVKESSSTNE-----QKAAV 274 Citrobact...
ChinaCDC:SFxv_5026 185 DIYRDIrasdsNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQM---LSYNQVNKIINSNFPQQDlcfqtEKLLF 261 Shigella ...
CAS10464           198 DTFRGL-----GNSDVSINGVSLSREAQQLLCHFIGLKDTGSSPPSNIINNGIDYDQAVILVSKSHVGEE-----QKALL 267 Escherich...
4FMA_B             229 VEFLCHPEAATAICSAFYQSFNVPALTLTHERISKASEYNAERSLDTP--------------NACI---NISISQSSDGN 291 Escherich...
CBG89704           275 VDFLCQPEAPTAICSAFYQSFNVPALMLTHVRISQASAYNAQRSLDMP--------------NACI---NISITQSSEGS 337 Citrobact...
ChinaCDC:SFxv_5026 262 TSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPeqrvinncghiikiNAVVpknDTAISASGGRA 341 Shigella ...
CAS10464           268 TAVLCQPEFVAAICSSFYQSFTVPAFLLMHERIFLARQHFSEKSLVLP--------------NAHF---SINISNSSNGG 330 Escherich...
4FMA_B             292 IYVTSHTGVLIMAPEDRPNEMGMLTNRTSYEVPQGVKCTIDEMVRALQP--RYAASETYLQN 351 Escherichia coli
CBG89704           338 IHVTSHTGVLIMAPEDRPNQLGMLTNRTSYEVPPGVKCEPNEMARMLKA--KYASSETYLNN 397 Citrobacter rodentium ICC168
ChinaCDC:SFxv_5026 342 YEVSSS----ILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPesRQVSFAIISPD 399 Shigella flexneri 2002017
CAS10464           331 LYVFNNVGTFIMAPGERGDVVGVFTMRTSYEIPLGTRCEIPELVRVIKP--IYSASEAYSRN 390 Escherichia coli O127:H6 st...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap