Conserved Protein Domain Family
DUF1258

?
pfam06869: DUF1258 
Protein of unknown function (DUF1258)
This family represents a conserved region approximately 260 residues long within a number of hypothetical proteins of unknown function that seem to be specific to C. elegans. Note that this family contains a number of conserved cysteine and histidine residues.
Statistics
?
PSSM-Id: 369115
View PSSM: pfam06869
Aligned: 7 rows
Threshold Bit Score: 417.605
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFO95800      122 EASSLWNFRKGQYSIRKFCNSCG-VTASRDRCDRCDG-KVLKFIRIDAFSQLVDLVDRNLPKIMKLRENLKSGR-NSAHN 198  Caenorhabditi...
2_pfamImport    1 LARNVWNYNRCTFSTHFFCNDCGrSLSKSERCKMCPNsCVAHYLRMGGFAQVCELVDAFLHEILKLRTDLKSGAvEVEHN 80  
EGT49951      115 DALRVWNFKKGMYSTLHVCNSCGkSVRNSETCE-CGG-KILKVTRVGAFSQLVDLVQEHSSKILKLREELRSGR-DKSHN 191  Caenorhabditi...
1_pfamImport    1 ---VLWNTEKKIFSVHFVCNKCGk---FSQKC--CG--PIVKFVRTGVFTQLTAIVDFYLDRIISIRRKLRAGD-EIDHP 69  
XP_003094926 1645 SARKLWYHRRFNFSSHSFCNQCGrTVLSNDKCSLCGSnSIAVFVRTGGFSQIMQLVKTFKTEILTLRENLKAGK-NVEHN 1723 Caenorhabditi...
Q22827          4 EARKLWEYTRNNFSTHTYCNLCGkVLGHINRCNICANaPVATFIRIGGFSQIRELVDSHLNEILQIREELKSGR-NVDHV 82   Caenorhabditi...
Q22778        159 SANSIWTYNKNNFSTHHFCNKCGkVAQNSKKCKYCGG-PVASFVRVGAFTQIVELVETYMDDILELREQLKNDR-NLEHN 236  Caenorhabditi...
EFO95800      199 LNAEYLKGRWKS-ETSKELNLTLLASVDGVTSHGNTKkKIWPITLKLADLPTSEMQKSINILLQGVIEGSENPSTVAWNQ 277  Caenorhabditi...
2_pfamImport   81 LNSPFFSHSWKS-EGEYFLNLSLLMSVDGVDIPGTKN-KIWPVCFSLIDLPRGLSQKSTNIILQGVVQCLQNPTTALWNA 158 
EGT49951      192 LNSEFLKKNWIE-ESAGLLHLTLLASVDGVSLKGNSKkKIWPVTLKLADLPIAEMQKSVNILLEAIVEGVENPSTVLWNH 270  Caenorhabditi...
1_pfamImport   70 LASPFLKPLWQAeKEEHSLLLSGVLSIDGVSVAGNTK-KLWPVSLILVDLPVAEMQRSSNVLLEGIAECVENPSTQFWNS 148 
XP_003094926 1724 LNSPFFESSWKM-ESGNHLNLSCVISIDGVQISGNTK-KLWPISLILVDLPSSQMQKSTNIILEGIIECSETPSTTLWNA 1801 Caenorhabditi...
Q22827         83 LGSPFFSRGWAN-ESKHHLHLSTLLSIDGVHIPGNNN-KLWPVSLLLCDLPIGLMQKSTHVILEGIVECSDTPSTALWNA 160  Caenorhabditi...
Q22778        237 LASPFFSSFRET-ESPNRLRLSLVVSIDGVRISGNKK-KLWPVSYIIVDLPTGLMQKSTNIVLGGIVECSENPTTTLWNA 314  Caenorhabditi...
EFO95800      278 LLPTVFMDVEGRTGEAGGVRFNAKIVTFTADQP-----------AKRSLFGMTAANSESSCLFGLCTGTLHK-TRGAGGG 345  Caenorhabditi...
2_pfamImport  159 LLPMICVDLESQTGKCAKYKFRATITTCTADQP-----------AKRSLFGFKGHTSSQSCFFCLSTETLHKtRGGESRS 227 
EGT49951      271 LIPIVFMDMENKVGEVDNIKFKASIVTFTADQP-----------AKRSLFGMAASNSEMSCFYGLCPGTLYK-TRGPERY 338  Caenorhabditi...
1_pfamImport  149 IQPLILSDLQSPRGVLSTCNFKLRCVTLTADQPfllfdnidilkAKRSFFGLRSHQSAKSCCYCLSDGTFYK-KDGPNRH 227 
XP_003094926 1802 VVPMIWTDIESYTGRIGVHSFSCRILSCSADQP-----------AKRSFFGMRSHQSSMSCFYCTSAGTMYK-LHGDSRK 1869 Caenorhabditi...
Q22827        161 LIPMFMTDIEHHIGRVKNITFSCRITTISADQP-----------AKRAFFGFRHHSAKLSCFFCLAPETYYK-HEGPNRK 228  Caenorhabditi...
Q22778        315 LIPFILSDVESHSGKVRNTSFTCHIRTCSADQP-----------AKRAFFGFMAHQSAESCFFCMSPGTLYK-FGDRKRR 382  Caenorhabditi...
EFO95800      346 TipTSKGVLTQQDSRSRNNGFKDIPPFV 373  Caenorhabditis remanei
2_pfamImport  228 I--LRRGQLTINDSVHVRNGFKCKADIV 253 
EGT49951      339 T--SRKGILTQQDSLNAQNGFKNVPSFI 364  Caenorhabditis brenneri
1_pfamImport  228 D--VRNGNLTVEDSRQGVNGFGPTASNA 253 
XP_003094926 1870 Q--TRLGSLTVSDSINSINGFGRIPSTV 1895 Caenorhabditis remanei
Q22827        229 L--SRPGHLTIQDSINGRNGFTEKKSII 254  Caenorhabditis elegans
Q22778        383 E--ERPGYETIVDSEQGVHGFGPIPAKI 408  Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap