2OYZ,3HQX


Conserved Protein Domain Family
DUF1255

?
pfam06865: DUF1255 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1255)
This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length. The function of this family is unknown
Statistics
?
PSSM-Id: 399686
Aligned: 141 rows
Threshold Bit Score: 107.17
Threshold Setting Gi: 497248588
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2OYZ_A             4 KENSYFAGGVKSLGFNQHGQDVSVGVXLPGEYTFGTQAPERXTVVKGALVVKRVGEADWTTYSSGESFDVEGNSSFELQV 83  Vibrio para...
CAL84742           2 KVNKYFGGKVKSMSFVNKEGEATIGLMDIGEYEFATCKKEFMTIVSGKMTVRLPGESIWKDFRKNDTFIVEANEKFNVKL 81  Clostridium...
WP_011988896       3 KSNSYFNGNVVSIAFNGVDGEATVGVMSPGEYEFGTSKQEHMKIISGSMQVKLPGEDTFKRYDKDDIFIVNANLKFNLIV 82  Clostridium...
jgi:Mmwyl1_1700   22 KVNSYFNDQVKSIALNNAEGTSTVGVMAVGEYEFGTSQREYMTVVSGTLTVKLPNEDDWKIFVKGDTFIVEANQTFQLKV 101 Marinomonas...
Q7USA1             2 QVNEYFDGNVTSIAFENGEGRATSGVMLVGDYEFGTSEKELMKIVSGKLEAKLPGEPGFRAYPAGSEFRIDANQKFQVRV 81  Rhodopirell...
chanu:ambt_09725   4 TVNSYFDDKVRSIAFESANGPCTSGVMAPGEYTFNTSQHEVMKVMEGEMTVKLPGSNDWQSFKTGTEFTIDANLSFDVKI 83  Alteromonas...
jgi:Palpr_2108     3 KTNQYFDGKVVSIGLESNEGTATVGVMAAGEYEFGTGTVEVMTVISGQLTIQQPDETEWKTYKKFESFVVAKDVKFKVKC 82  Paludibacte...
WP_015402573       3 KTNEYFDGKVKSIAFTSEDGPATIGVMAVGEYEFGTGSVEIMSVVSGSMDIKLPETDTWQTFTAGESFEVAKDVKFGVRI 82  Desulfocaps...
WP_015425341       3 TVNEYFEGKVKSIAFQNEQGNFTVGVMDIGEFEFGTNTIERMTVISGELTVQLPEEETWKKFTSNETFTVPAHKKFRVKV 82  Candidatus ...
CDF79762           3 SSNTYFDGNVKSLGYQSATGASTLGVMEAGTYEFATDKHETMNVIEGTMTVLLPESSNWKTFKAGESYQIEANKTFQVKV 82  Formosa aga...
2OYZ_A            84 KDATAYLCEY 93  Vibrio parahaemolyticus RIMD 2210633
CAL84742          82 QEQTVYICFY 91  Clostridium botulinum A str. ATCC 3502
WP_011988896      83 EVETAYLCLY 92  Clostridium kluyveri
jgi:Mmwyl1_1700  102 TEMTAYLCRY 111 Marinomonas sp. MWYL1
Q7USA1            82 IEPTAYLCFY 91  Rhodopirellula baltica SH 1
chanu:ambt_09725  84 ETPTAYLCFY 93  Alteromonas naphthalenivorans
jgi:Palpr_2108    83 TEDTPYLCLY 92  Paludibacter propionicigenes WB4
WP_015402573      83 TQETSYICLY 92  Desulfocapsa sulfexigens
WP_015425341      83 QEQTAYLCRY 92  Candidatus Cloacimonas acidaminovorans
CDF79762          83 AEQTSYLCQY 92  Formosa agariphila KMM 3901
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap