Conserved Protein Domain Family
UTP25

?
pfam06862: UTP25 
Utp25, U3 small nucleolar RNA-associated SSU processome protein 25
UTP25 is a family of eukaryotic proteins. The family displays limited sequence similarity to DEAD-box RNA helicases, having alternative residues at the Walker A and DEAD-box sites, but conservation of structural and other key residues. The domain is required and sufficient for the interaction of Utp25 with Utp3. UTP25 interacts with nucleolar protein Nop19 in S. cerevisiae, and Nop19p is essential for the incorporation of Utp25p into pre-ribosomes.
Statistics
?
PSSM-Id: 369113
View PSSM: pfam06862
Aligned: 26 rows
Threshold Bit Score: 507.95
Threshold Setting Gi: 122052838
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5KEA3       197 IPLLSTYLSHLGTYKDYYLHSLdgEADgSetqligqhKEAMRKAAVIHSVNHVLKTRRRIIRNNEKLAHAAssd----ns 272 Cryptococcus ne...
Q8H1E7       259 SSKRRKFFSICNSYLDILHSNK--KPFyHcgs---deDSSAMDAYLMHSLNHIFKTRDLVKKNESKIAKHRetse---ee 330 thale cress
XP_001309667 117 KIMDKIIANPIFDYEDFLYTTK--PED-T--------IDEVRKITALHVLNHVINDFD--AKKNRPTGSLK--------- 174 Trichomonas vag...
Q9W1G1       211 TALQSQLFYIANNYQDIYYPHR--THG-N--------AEDIRYVYCLHALNHMLKVRSLILRNNEKVSALAksqkmspne 279 fruit fly
NP_001098822 273 TPLQKELFLIMNSYRDLFYPER--TALkN--------GEEIRHVYCLHVINHVLKANAQVLGNNSRRRSQKlg------- 335 cattle
Q642T7       286 TPLQRELFSIMNSYRDLFFPAR--SPTaQ--------GEEIRHVYCLHALNHVLKANAQVLNNNSQKRDQKp-------- 347 tropical clawed...
Q6PEH4       273 TELQKEMLGLMGTYRDLYLANL--SPLkE--------AKEVRSAYCLHALNHVLKANSRVLRNNAKLKESK--------- 333 zebrafish
XP_011386525 195 TPLHKALATTLASYADFCDANV--ALN-D--------RPQYRQVLAMHAMSHIAKTRRRVLKNNEKLAKLAaans---as 260 Ustilago maydis...
O74974       187 TSMQIELAKAMFNYQDVFFTNM--SMK-S--------HKLGTSLLALHALNHVFKTRDRVLKNSARIS------------ 243 Schizosaccharom...
Q54HT2       373 TNLQKNLFPIFNEYRDLLYTEE--SMK-N--------HKSIFKLYALHAVNHIFKSKDQLSEDNALINECKk-------- 433 Dictyostelium d...
Q5KEA3       273 tSVAE-PPRDQSFIRPKVLFLLPTRSLALSYIKThLFPLAPAGt-------QIENQRSFVSSFSLPQDEedplanPSTSa 344 Cryptococcus ne...
Q8H1E7       331 iLSDD-GFLDQGFTRPKVLILLPLRSIAFRVVKR-LIQLTPESqr-----vNVEHLDRFNDEFGCEEDTddcdgeKTTSk 403 thale cress
XP_001309667 175 --------RDSGFTPTVVLIIASSKLQAYKFVSD-LLEFVPEDi-------LIEHEDRFRLEYGAEVPNgvi-------- 230 Trichomonas vag...
Q9W1G1       280 iSIPE-SFRDQGLKRMKVVFVVPFRESALRIVNI-LGDLLFGSqddqarktSIANYERFLGDYSGNTIY------FPKTn 351 fruit fly
NP_001098822 336 vGDDD-DFRDQGLTRPKVLIVVPFREAALRVVQL-FISLLEGDskk---kiIVSNKKRFNGEYGSDPEE------RPPNl 404 cattle
Q642T7       348 -GLDEeDLRDQGLTRPKVLIVVPFRESALRIVQI-LISLMEVGgr----kvDVSNKKRFKEEFGSEPED------RPPNl 415 tropical clawed...
Q6PEH4       334 -NGDE-DFRDQGLTRPKVLILVPFRDGALRVVQT-FMTLLEPKgk----ktDASNKKRFKEEYGEETDE------KPPNl 400 zebrafish
XP_011386525 261 tDSDDlDLRDQGFTRPKVLILLPFRNSALEWVDL-LTKFSLCS--------QVDNKSRFSKEYDLPEGAvdkladPAVAa 331 Ustilago maydis...
O74974       244 -QNPElEFRDQGYTRPKVLILLPTRNSAFEFINL-LISYSGTN--------QVENRKRFDNEFSIEKEV------ISEK- 306 Schizosaccharom...
Q54HT2       434 lKKPEpDLRHQGFTRPKVVIIVPFRNTAFEIVRF-ILKLVPHElk-----dQVENKTKFNNEYTQFDQDqei-------- 499 Dictyostelium d...
Q5KEA3       345 ---------dFPIDHLVNF-RGNSDDNFRFGIKITRKAWRVVmmpaneEKLIDCDILISSPLGFKMAAE-----REDSTD 409 Cryptococcus ne...
Q8H1E7       404 ngnsikqkssKPSDWQALFgANNNDDEFMLGIKHTRKSIRLY------GDFYSSDIIVASPLKLHMAIGaaeenKERDVD 477 thale cress
XP_001309667 231 --------qsHPKDWLAYF-GGNNEQDFKTAIRFFGDKISLC------QQMSKSQIVIASPVGIML---------HKDTS 286 Trichomonas vag...
Q9W1G1       352 ---------pKPMDYEQTF-SGNTDDNFKLGIRFTKKTMSLF------SDMNASDMLIASPLGLRMLVTd----KESDFD 411 fruit fly
NP_001098822 405 ---------kRPEDYEAVF-VGNIDDHFRIGVAILQRSIRLY------APFYSSDILIASPLGLRTIIGge-geKKRDFD 467 cattle
Q642T7       416 ---------kRPEDYEAVF-AGNIDDHFRIGVAILQKSMRLY------SPFYSSDIIIASPVGLRTIIGse-geKKRDFD 478 tropical clawed...
Q6PEH4       401 ---------qRPDDYHAVF-SGNIDDHFRIGMSILRHSMRLY------APFYSSDIIIASPLGLRTVLGae-geKKRDHD 463 zebrafish
XP_011386525 332 ---------kYPQDHIANF-AGNIDDSFKLGLKVTRKSLKLF------SGFYDSDVIVASPLGLRLGIEk----DKGDSD 391 Ustilago maydis...
O74974       307 ----------KPEDFRYLF-SGNTDDMFRLGVKFTRKTVKLF------SQFYNSDIIVASPLGLRLAIGnk-gdKKRDLD 368 Schizosaccharom...
Q54HT2       500 -------nenKPDDYKYIF-RDNIDDCFRFGLSFRKGGVKLY------STFYHADIIIASPLGLRLVIGte-gdSQRDFD 564 Dictyostelium d...
Q5KEA3       410 LLSSLEICIVDGVDVMQMQNWEHVQFIFNNINQIPKSPHGCDFSRVKPWYLESQAKYLRQTIIFGRYDTVEARALFNRSC 489 Cryptococcus ne...
Q8H1E7       478 YLSSIEVLVIDHADIISMQNWSFLATVVDYLNRLPTKQHGTNVMRIRPLYLDGHARFYRQSIILSSYLTPEMNSLFGRHC 557 thale cress
XP_001309667 287 FLSSIEILVLDTLDFLEVQNSQRLSECIKTINQKPMTVEETDWSRLRTYFSDKNHPKMRQNIGYATVMTPEMISLF-SSF 365 Trichomonas vag...
Q9W1G1       412 FLNSIELLIIDQAELFLAQNWENLLHSLDHLHLQPQKLPDTNCQRVRTWCLSGASSFYRQTLFFSSHELPEFRAVFNSKC 491 fruit fly
NP_001098822 468 FLSSIELLIIDQADIYLMQNWEHVLHLMNHMNLLPLDSHGVDFSRVRMWSLNNWSKYYRQTLLFGALQDAQINSVFNKYC 547 cattle
Q642T7       479 FLSSIEVLILDQADLYLMQNWEHVLHLMAHLNLQPTDSHGVDFSRVRMWNLSNWAKYYRQTLLFSSLQEPQINSIFNKHC 558 tropical clawed...
Q6PEH4       464 FLSSIELLIVDQADVFLMQNWEHLLHVLEHLNLQPLDSHGVDFSRVRMWNLNNWAAYYRQTLVFSAIQEPQITNILTKHC 543 zebrafish
XP_011386525 392 FLSSIEMLIVDQTDVISMQNWEHLEFVMERLNQIPRQSRDTDFSRVKQFYLDNRAAMFRQTVLLSAYDFPSLRSVYNHKL 471 Ustilago maydis...
O74974       369 YLSSIEIAMVDQAHALVMQNWEHIECIFDELNGLPKEAHGCDFSRVRPWYLDQQARYMRQTILFSQYNNLDINSFFSHYM 448 Schizosaccharom...
Q54HT2       565 FLSSVEVLIIDQIDSIQQQNWDHINVLFENLNRIPTQDHNIDFSRLRNSSLEGLSSNLRQTLLFSSNLTPELNSIFNQHC 644 Dictyostelium d...
Q5KEA3       490 HNLQGKVRSERNDFGg--VMDRVRPGVRQVFERFDlegpkgmnGEAAVDEVEKRLKFFTENTIPALLRa---aISRQNTL 564 Cryptococcus ne...
Q8H1E7       558 LNYKGKMKMACEYKG---VLEKVLLPVRQIYERFD--------AASITQVDDARLEYFTKKIFPKIKD-----SVQGGVM 621 thale cress
XP_001309667 366 ENIRGSNIVKQSFTK---SL--FNPGVEQVFRRIP--------APNIVSTADQNFKIFQLRILPQIKAwraasDKPGRTI 432 Trichomonas vag...
Q9W1G1       492 NNYQGKVRDSNLVEHg--DIRNVLTPIHQVFRLIN--------CSSVETTFDDRFQYFVKNIMPQFSK-----PGFSHCM 556 fruit fly
NP_001098822 548 VNVQGQVAVRSVPMTg--SISRVLVQLPHVFQRMQ--------VESLASVIDARFNFFVNKILPQYRD-----AVMSHTL 612 cattle
Q642T7       559 FNYCGQVAVRNMPVTg--SISHVVVQLPHVFQRLE--------ADSLLTVIDARFEFFTSKILPQYRD-----AIMSHTL 623 tropical clawed...
Q6PEH4       544 HNYRGQVCSKTIPKIg--SICQVLVQLPHVFQMFH--------SDSFMDQ-DARFQFFVDKILPQYRD-----SVMSHTF 607 zebrafish
XP_011386525 472 NNIAGKIRTIASTSEtqaEMSRVVSGVRHMFSRFE--------AANPHAEPDLRFAHFTNKTLQQLSKs---aIASSHTL 540 Ustilago maydis...
O74974       449 SNIAGKVKFRSLLHG---VLNRLGYKVTQTFVRIS--------VDSIIKVPDARFSYFTGSILVQLKK-----YSQSGIL 512 Schizosaccharom...
Q54HT2       645 KNISGKIRIKKIKNG---EITNIVPSLRQTFHRLY--------LDS-NDDSKIRFNFLIDNILPKFVQq----GENSGIL 708 Dictyostelium d...
Q5KEA3       565 IVIPSYFDFVRVTNYLRKa---------DKVSFAAISEYSSNAEISRARTLFFKGKKAFLIVTERFHFYRRYKIRGAKTI 635 Cryptococcus ne...
Q8H1E7       622 IFIHSYFEFVRLRNFLNT----------QNTSFCLLGDYAKNADISRAREQFFVGSRKIMLYTERAYFYKRYKIRGIKNL 691 thale cress
XP_001309667 433 IFFASSMLFYRARKLLDD----------SGVIFLELADEATKKDSIKMRKAYTEDPNAVMLITERYYFHFRPKFLDTGRI 502 Trichomonas vag...
Q9W1G1       557 LYVPSYFDYVRIRNHFKT----------EMVSFVQINEYTKKEKISRARDIFFHSGASVLLYSERAHFFRRTRIKGIRNL 626 fruit fly
NP_001098822 613 IYVPSYFDFVRLRNYFKK----------EELNFAHICEYTQKSGVSRARHFFLQGEKQFLLLTERFHFYKRYTIKGIRNL 682 cattle
Q642T7       624 IYIPSYFDYVRLRNYFKK----------EELNFTHICEYTNRSGVSRARQFFLKGERQFLLVTERFHFYKRYTLKGIRNL 693 tropical clawed...
Q6PEH4       608 IYVPSYFDFVRLRNYLKK----------EDVSFANISEYSQRSEVSRARHYFQKGEKQFLLFSERFHFYKRYTIKGIHNL 677 zebrafish
XP_011386525 541 IVVPSYFDFVRLDAFLREhnekrkpgqtANLSYTSISEYSSPKDIRRARESFFSAKKRFLLLTERAHFYRRFKLRGVQTV 620 Ustilago maydis...
O74974       513 VYIPSYFDFVRVRNYMDE----------EGINYSAISEYSSVSDMTRARNLFYQGRTNIMLYTERAHHFRRFDFRGVKAV 582 Schizosaccharom...
Q54HT2       709 LYISNFFEFTMIRNYFRK----------EAKSYVICSEYTDPKAVTRARSQFKESAKTIMLFTERFHFFNRYHIRGIKHV 778 Dictyostelium d...
Q5KEA3       636 VFYSLPDHAQFYSEFMDtpFLASknkse-------devdiDEAEVSSRVLYSRFDALKLERVVGSENARKLLKTSESRFE 708 Cryptococcus ne...
Q8H1E7       692 ILYSLPERKEFYPEIMN--MLEE-----------------GSHDMMSTALFSRFDMLQLERIVGSTSAKRMITSEKNMFA 752 thale cress
XP_001309667 503 IFYGAPTYPQFVSELAK--------------------------DIPVFLYFNEYDDLALERLCGGEMAMRLVK--DEVYL 554 Trichomonas vag...
Q9W1G1       627 IMYQPPNFPHFYSEIIN--LMLKtnqn---------prdgFGDEMSVSILYTKYDLLSLSNIVGSENAAKLTSGQKDSYL 695 fruit fly
NP_001098822 683 IFYELPTYPHFYSEVCN--MLRAtsrg-------------eeaAWTCTVLYSKYDAQRLAAVVGVERAAQMLQSKKNVHL 747 cattle
Q642T7       694 IFYELPTYPHFYSEVCN--MMKAwhrg-------------eeaTWTCTVLYSKYDAQRLAAVVGAERAAQMLQSKKNVHL 758 tropical clawed...
Q6PEH4       678 IFYGLPTYPHFYSEVCN--MLQAgvre-----------ggaSVSFTCTALYSRYDVHRLAAITGADRAAQMLQSKKTTHL 744 zebrafish
XP_011386525 621 VFYQLPQNARFFSEVLEfpFVTKadlakgrgdahddeqeiDPNQVSTYVVYSKYDLMALEKVVGSEQAKQMVVADKATWK 700 Ustilago maydis...
O74974       583 VMYGPPTNPQFYVELVR--MPMRtise----------gnlDSDAAKCRIMYTKFDSICLEGIVGYQRVSNMCHGKHEVFE 650 Schizosaccharom...
Q54HT2       779 IFFGLPQNSHFYSEILN--MITE-------------------NDGSIISLYTLKDKMALERIVGTQRSYKMLESDKPTHL 837 Dictyostelium d...
Q5KEA3       709 F 709 Cryptococcus neoformans
Q8H1E7       753 F 753 thale cress
XP_001309667 555 I 555 Trichomonas vaginalis G3
Q9W1G1       696 F 696 fruit fly
NP_001098822 748 F 748 cattle
Q642T7       759 F 759 tropical clawed frog
Q6PEH4       745 F 745 zebrafish
XP_011386525 701 F 701 Ustilago maydis 521
O74974       651 F 651 Schizosaccharomyces pombe 972h-
Q54HT2       838 F 838 Dictyostelium discoideum AX4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap