Conserved Protein Domain Family
BALF1

?
pfam06861: BALF1 
BALF1 protein
This family consists of several BALF1 proteins which seem to be specific to the Lymphocryptoviruses. BALF1, inhibits the antiapoptotic activity of EBV BHRF1 and of KSBcl-2.
Statistics
?
PSSM-Id: 115513
View PSSM: pfam06861
Aligned: 2 rows
Threshold Bit Score: 299.623
Threshold Setting Gi: 81966167
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q91HI3   1 MrpaksTDSVFVRTpveawvAPS-PPDDKVAESSYLMFRAMYAVFTQDE-TGLPLPAMVLCRLIKASLKKDKKLYAELAC 78  Gorilline gammaherpes...
Q993L0   1 M-----TDDVFQDN------APNlGAEDEMDRGVLLLTRVMIAAYLDDPgKGLGTEERLFLRLIKRLMKKEEKRFADIVN 69  Marmoset lymphocrypto...
Q91HI3  79 KTADIGGKHAHVQLIISVLRAVYDDHYDYWSRLRVVLCYTVVFAVRNYLDDHESAAFVLGAIAHYLALYRRLWFARMGGM 158 Gorilline gammaherpes...
Q993L0  70 SGSAPTTLHGHIKRLMTFTRAIYEDHMDNWFRVRALTSLAVAYARRNIPGDSENAGLLLVGFAEFLCLYRRAWLSRLGGI 149 Marmoset lymphocrypto...
Q91HI3 159 PRSLRRQFPVRWALAGLTYFLKSL 182 Gorilline gammaherpesvirus 1
Q993L0 150 RVGLRRAFPLTWMRMRVGESCYKQ 173 Marmoset lymphocryptovirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap