2O35,3FYB


Conserved Protein Domain Family
DUF1244

?
pfam06844: DUF1244 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1244)
This family consists of several short bacterial proteins of around 100 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 399674
Aligned: 70 rows
Threshold Bit Score: 105.015
Threshold Setting Gi: 122543123
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2O35_A             33 QNIDLXNLAGFCRNCLSNWYREAAEASGVPXSKEESREIVYGXPYEEWRTQNQGEASPEQKAAFE 97  Sinorhizobium meliloti
IBRC:GU3_12340     28 QNIDLMNLAGFCRNCLSKWYLAAAEERGLEMNYDEARERVYGMPYGEWKEKYQKEATAEQKAAFE 92  Oceanimonas sp. GK1
Q88E35             28 QNIDLMNLSGFCRNCLSKWYKAAADERQLDLSLDDAREAVYGMPYAEWKAQYQKEASAEQQAAFE 92  Pseudomonas putida KT2440
WP_003245967       28 QNIDLMNLAGFCRNCLSKWYKAAADDLGVEVSADQARETVYGMPYADWKAKYQKEATAEQKAAFE 92  Pseudomonas
WP_015488253       25 QNIDLMNLAGFCRNCLAKWYTSAAAEGGEALTYDAAREIIYGMPYDVWKAQYQQEATPEQLAAMN 89  Thalassolituus oleivorans
WP_014954848       31 QNIDLMNLSGFCRNCLSKWYGKYSSELGYDLDYEETRKIIYGMPYSDWKEKFQKEATAEQLKNLK 95  alpha proteobacterium HIMB59
3FYB_B             32 QNIDLXIQADFCRNCLAKWLXEAATEQGVELDYDGAREYVYGXPFAEWKTLYQKPASEAQLAAFE 96  Alcanivorax borkumensis SK2
Q1QW88             31 QNIDLMILADFCRNCLSKWLVAAAEQRGIELDYETAREHVYGMPYSEWKALYQAPATPEQLAALE 95  Chromohalobacter salexige...
Q15Y88             28 QNIDLMILADFCRNCLSKWYMAGAKEQGVDMDYDQAREAIYGMPFADWKAKYQTPATPEQLEAFE 92  Pseudoalteromonas atlanti...
zhongguo:Q91_1388  29 QNIDLMNLADFCRNCFSKWYMAEAKERDVDIDYEAAREVVYGMTFAEWKEKYQLPATPEQLAEFE 93  Cycloclasticus sp. P1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap