5VIT


Conserved Protein Domain Family
MdcE

?
pfam06833: MdcE 
Click on image for an interactive view with Cn3D
Malonate decarboxylase gamma subunit (MdcE)
This family consists of several bacterial malonate decarboxylase gamma subunit proteins. Malonate decarboxylase of Klebsiella pneumoniae consists of four different subunits and catalyzes the conversion of malonate plus H+ to acetate and CO2. The catalysis proceeds via acetyl and malonyl thioester residues with the phosphribosyl-dephospho-CoA prosthetic group of the acyl carrier protein (ACP) subunit. MdcD and E together probably function as malonyl-S-ACP decarboxylase.
Statistics
?
PSSM-Id: 399666
View PSSM: pfam06833
Aligned: 6 rows
Threshold Bit Score: 277.069
Threshold Setting Gi: 81792682
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5VIT_M        27 AWFQALAGSlapRPGDPASLRVADAELDGYPVRFLAVVPDPDnpfprarQGEVGLLEGWGLAAAVDEALeadrEAPRKRA 106 Pseudomonas aer...
Q87V58         9 NWFNALSADaseVTGLPASLKVADGLLGEQPVRFVAVIADTNnrfprarQGEVGLLEGWGLAKAVDDAIeqdrERAEKRA 88  Pseudomonas syr...
WP_015958368  10 lWLNKLAPDaplMSGLCPSVQVTDGQINGESVRFIAVVPDANnhypraaGGEVGLLEGWTLAKVVNETIaadaDRPVKRP 89  Klebsiella pneu...
Q8P4U4         5 ALFDQLFPL---GHAIACHDDVLTGSATT-AAGEVTVIGTAN-------KLEVGVDHALALAATVLAST----RTHPQRP 69  Xanthomonas cam...
Q89XP1         5 DIIASLFPD---GHEVSNDNGVLHGSATLRSGGTMLVIGIAN-------RTALGVDEAIRLSAHVLKSI-----GRDSGP 69  Bradyrhizobium ...
Q89UY5         5 DILAGLFPN---GRKIETTGAMIAGQATLPDGGPIHVLGITQ-------GQPLGVDEAIALAGRVIEII----KSNDRAP 70  Bradyrhizobium ...
5VIT_M       107 LLAIVDVPSQAYGRREEALGIHQALAGAVDAYARARLAGHPLIGLLVGKAMSGAFLAHGYQANRLIALHdpGVMVHAMGK 186 Pseudomonas aer...
Q87V58        89 LIAIVDVPSQAYGRREEALGIHQALAGAVDSYARARLAGHPVIGLLVGKAMSGAFLAHGYQANRLIALRdpGVMVHAMGK 168 Pseudomonas syr...
WP_015958368  90 IVAVIDVPSQAYGRREEAFGIHQALAGAAGAYAKARLAGHPVIGLIVGKAMSGAFLAHGYQANRLIAFNdsGVLVHAMGK 169 Klebsiella pneu...
Q8P4U4        70 IVMLADTAGQRLARGDELLGINGYFAHLAKSLDLARARGARLVTLVYGESVSGGFLSFGLMADHIHALP--DAQIRVMDL 147 Xanthomonas cam...
Q89XP1        70 ILVLVDSDSQRMSKRDELLGLNEFLAHLAKVLIHADMNGRPTIGVLYGHSAAGALLATGLATRVLVGLP--GADPAVMDL 147 Bradyrhizobium ...
Q89UY5        71 ILVLVDSASQRMSKRDELLGLSEYLSHLAKALLLAEAEGHRTVGLLYGGSAAGAFIATALATGTLVALP--GAHPAVMDL 148 Bradyrhizobium ...
5VIT_M       187 AAAARITLRSVEELEALAAKVPPMAYDIDSYASLGLLWRTLPVETVEVPSTADLVRVRTCLGEalADIlggprdlgGRLG 266 Pseudomonas aer...
Q87V58       169 ASAARVTQRSVDDLEKLAASIAPMAYDIDSYASLGLLWETLSVSQIEQPAVDDLTQVRQVLSSaiKDVqasgvdlsSRLG 248 Pseudomonas syr...
WP_015958368 170 ASAARITLRTVEALEKLAATIPPMAYDVSNYATLGLLSALLDISNPDAPDEGDLSLVSRTLRDaiADArtdt-slkCRLG 248 Klebsiella pneu...
Q8P4U4       148 RAMARVTKQTVDTLQALSKSSPVFAPGVENYVRMGAVESLWDGDLAQALLDALATPSTG-------DQ--------RRTL 212 Xanthomonas cam...
Q89XP1       148 PSMAKVTKLSMEALQEKAKSTPVFAPGLSNLAQMGAVHMTWS--NAASLADQLEALLADMPAA--QDR--------RDAL 215 Bradyrhizobium ...
Q89UY5       149 PSMARVTKLPIEVLKAKAEATPVFAPGLDNMVRTGGIHVVWD--ETAPLAPQLAAVLAQ-PAG--RDE--------RSRL 215 Bradyrhizobium ...
5VIT_M       267 AANREASARVRRLLREQW 284 Pseudomonas aeruginosa
Q87V58       249 ASNRKASAHVRQLLRAQW 266 Pseudomonas syringae pv. tomato
WP_015958368 249 AENRRSSQLVRDRMRASW 266 Klebsiella pneumoniae
Q8P4U4       213 GAERGGRTLARDVSAAVA 230 Xanthomonas campestris pv. campestris
Q89XP1       216 GKQRGGRLKAAEIAERVR 233 Bradyrhizobium japonicum
Q89UY5       216 GAERGGRRKAAEIADRVV 233 Bradyrhizobium japonicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap