Conserved Protein Domain Family
Root_cap

?
pfam06830: Root_cap 
Root cap
The cells at the periphery of the root cap are continuously sloughed off from the root into the mucilage, and are thought to be programmed to die.This family represents a conserved region approximately 60 residues in length within plant root cap proteins, which may be involved in the process.
Statistics
?
PSSM-Id: 399663
View PSSM: pfam06830
Aligned: 38 rows
Threshold Bit Score: 90.0089
Threshold Setting Gi: 460390372
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAH67155           263 AFKFYSISADVHGVLGQTYRPDYVSAgVDVGAKIPVMGGAGKYAVSDIFATDCEVARF 320 rice
XP_015617828       331 AFKFDALTGDVHGVVGQTYRSDYVNK-FDVRASMPTLGGDHSFATSGLFAADCAVSRF 387 Japanese rice
XP_004960556       257 GFKFYDLTDDVHGVLGQTYRTDYVNR-LNVTAKMPVMGGADNFVSSGLFETDCAVARF 313 foxtail millet
XP_020198363       267 GFKFQALSDDVHGVLGQTYRSDYVNK-LNVTSKMPIMGGTADYVSSALFASDCAVTRF 323 Aegilops tauschii subsp. tauschii
OQU88252           283 GFQFHNLTGDVDGVLGQTYRPGYVTK-LNITANMPIMGGAPNYRSAGLFSTDCAVSRF 339 sorghum
KQK09956           268 GFRFHSLTEDVDGVLGQTYRPDFVSK-VDITANMPIMGGAPKYLSSSLFSTDCAVSRF 324 stiff brome
AQK49652           275 sYKFHGLTKDVDGVLGQTYRPDYVNK-LDISAKMPVMGGADKYRSSGLFATDCAVSRF 331 Zea mays
XP_004971399       249 GFKFHDLTDDVHGVLGQTYRPDYVNK-LDVKSNMPVMGGAPDYLSSDLFSTDCAVARF 305 foxtail millet
WGS:AAAA:OsI_05357 244 GFKFYDLSDDVHGVLGQTYRSDYVNK-LSVSASMPVMGGAPSYVVSDIFSTDCAVARF 300 long-grained rice
XP_003567518       254 GFRFQGLTDDVHGVLGQTYRPDYVNK-LSVRASNPIMGGVASYVSSDIFATDCAVARF 310 stiff brome
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap