5M7Y


Conserved Protein Domain Family
Glyco_hydro_125

?
pfam06824: Glyco_hydro_125 
Click on image for an interactive view with Cn3D
Metal-independent alpha-mannosidase (GH125)
This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
Statistics
?
PSSM-Id: 399660
Aligned: 222 rows
Threshold Bit Score: 450.357
Threshold Setting Gi: 302849067
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5M7Y_A          25 DKKLQELFYNCFINTMDTTVEVSEG----DAFVITGDIPAMWLRDSTSQVEHYLPFVKEYPELKAIFTGLINRQVKCIFI 100 Clostridium p...
WP_013444305    61 DPELAWMFGNCFPNTLDRTVTFTQKngkpNTFVITGDIYAMWLRDCSAQVWPYMPYMKEDPSLQQLIAGVINRQAESVLI 140 Paludibacter ...
CDD32467        69 DDKLKWMFINCFPNTLDTTVKFKMRdgypDTFVITGDINAMWLRDSSAQVQNYLSLAAEDEALREMIKGLINRQLDCILV 148 Bacteroides s...
CDD32914        60 DPKLRWMFENCFPNTLDTTVEFRMKgdkpDTFVITGDIHAMWLRDSSAQVWPYLQLLKEDKNLQNLVIGLINRQAQCILI 139 Bacteroides s...
WP_013545726    69 DDKLRWMFENCFPNTLDTTVRYKMRngipDTFVITGDIDAMWLRDSSAQVWPYLPLMKDDKELQLLIAGLVNRQAECIRI 148 Bacteroides h...
WP_012788743    63 DQKLAWMFENCFPNTLDTTVQFKVEngrpDTFVLTGDIHAMWLRDSTAQVWPYLSLIKEDDKLKQLIAGVVNRQTKCVLI 142 Chitinophaga ...
jgi:Solca_2730  63 DQKLAWLFENCFPNTLDTTVYHKTIdgkpDTFVITGDIDAMWLRDSSAQVWPYVPLAKNDKKLQSLLAGVINRQAKCILI 142 Solitalea can...
WP_038559350    65 DPKLAWMFENCFPNTLDTTVEHGTLngkpDTFVITGDIHAMWLRDSTAQVWPYMPLANQDDELKTLLAGVVHRQTQCVLL 144 Draconibacter...
WP_008780859    78 DPKLAWMFENCYPNTLDTTCEFKMVdgkpDTFVITGDIHAMWLRDSSAQVYPFVTLAKKDKDLRQMLVGAINRQTACILI 157 Bacteroidales
WP_021988424    76 DPKLAWMFENCFPNTLDTTVDFKMRdgrpDTFVITGDINAMWLRDSGAQVWPYLPLCKDDEQLRLLVAGVINRQTQCILL 155 Culturomica m...
5M7Y_A         101 DPYANAFN--KEpngQKWDn-DITKd-sPWVWERKYEIDSLCYPVRLIHKYWKESGDETFFNddIKKAFNMIIDLWRVEQ 176 Clostridium p...
WP_013444305   141 DPYANAFNmnKE---GGMWmsDNTQm-rPELHERKWEVDGLCYVIRLGYRYWKLTGDTSSFDsrWLDAMKLIVKTFKEQQ 216 Paludibacter ...
CDD32467       149 DPYANAFN--DGp-tAAGWqtDATEm-rKEVNERKWEIDSLCYPIRLIYQYWKATGDDSVFNakWEKAMALILKTFQEQQ 224 Bacteroides s...
CDD32914       140 DPYANAFN--DGp-lGSYWetDNTQhmvKELHERKWEIDSLCYPIRVAYHYWLITGDSSVFDavWHDAMKLVVQTFKEQQ 216 Bacteroides s...
WP_013545726   149 DPYANAFN--DGp-lGSYWetDHTQymaKELHERKWEIDSLCYPIRLAYHYWSLTKDTAIFSsnWHEAMKLVVQTFKEQQ 225 Bacteroides h...
WP_012788743   143 DPYANAFN--EGp-tGSEWdsDLTEm-kPELHERKWEIDSLCYTVRLAYNYWKVSGDASVLDdtYKKAAKLIVKTFKEQQ 218 Chitinophaga ...
jgi:Solca_2730 143 DPYANAFN--DGp-kGSEWekDLTEm-kPELHERKYELDSICYPIRLAYGYWKSTGDVAVFGdeWKKAMELVYHTMIAQQ 218 Solitalea can...
WP_038559350   145 DRYANAFN--KTkeeEVHWmsDMTDm-kPGLHERKWEIDSLCYTVRLAYNYWLTTGDKSVFDadWQKAAALIVKTFKEQQ 221 Draconibacter...
WP_008780859   158 DPYANGFN--EGp-tGSEWesDRTEm-kKELHERKWEIDSLCYPIRLAYHYWKEVGDTSVFDskWEQAMEAVYRTFREQQ 233 Bacteroidales
WP_021988424   156 DRYANAFT--HGt-eSSEWasDLTEm-kPYIHERKWEIDSLCYPVRLAYHYWKITGDTSVFDkeWTRAMGLVIQTFKEQQ 231 Culturomica m...
5M7Y_A         177 YhREKSDYSFQRLNCSVTDTLSHEGLGTPVTYtGMTWSGFRPSNDACEYGYLIPANMFAVVALRYISEIAEKVYKDeelK 256 Clostridium p...
WP_013444305   217 RkTNQGPYSFMRRTERAIDTQFGNGFGNPVRPtGMICSAFRPSDDATIYGYLVPSNCFAVVSLRQLSEMVKSIKQDkafA 296 Paludibacter ...
CDD32467       225 RkENDGPYSFERHTGNAIGTLVNRT-GNPVNPvGMVVSSFRPSDDATIFGFLVPSNMFIVASMRQLSEIIRTTGNGknlL 303 Bacteroides s...
CDD32914       217 RkDGLGPYSFTRDCDRPTDSQINGGFGAPVKPvGLIYSAFRPSDDATQYGFLIPSNMFAVVSLRQLAEIETKVYGNkefA 296 Bacteroides s...
WP_013545726   226 RkQNLGPYSFTRDCDRPTDSQINGGWGAPVKPvGLIVSSFRPSDDSTQYGFLIPSNMFAVVSLRQLAEIETVVYKNgdfA 305 Bacteroides h...
WP_012788743   219 RkEGKGPYKFQRKTPIQSDTAPNGGWGAPIQPvGLIVSLFRPSDDATVFPFLIPSNMFAVVSLRQLSEISEVVFKDaafA 298 Chitinophaga ...
jgi:Solca_2730 219 RkTERGPYKFQRVTGWQSDTVAGAGYGAPIKPvGLIVSIFRPSDDATIYPYLIPSNLFAIVSLRQLAEIMKEVYKDeamA 298 Solitalea can...
WP_038559350   222 RkDDLGPYKFQRETAQQLDTVANHGYGRPLKPvGLINSTFRPSDDATTYGFLIPSNIFAVVSLKQLAEISNEVTGDkafA 301 Draconibacter...
WP_008780859   234 RkDSLGPYRFSRVTDRQGDTLLNDGWGSPVNPvGLIVSSFRPSDDATLFGFLVPSNLFAITSLRQVAEILRAVRNNtdlA 313 Bacteroidales
WP_021988424   232 RkTEKGPYKFQRRTERQLDTLNNDGWGNPVNPvGLIVSCFRPSDDATTFGFLIPSNLFAVTSLRQMAEIAEKVTGNstlA 311 Culturomica m...
5M7Y_A         257 EKADSLREEIDNAIEKHGKVYKEGFGEVYAYETDGMGNYNFMDDANVPSLLSIPYLEYKGIEDEVYQNTRKFILSKNNRF 336 Clostridium p...
WP_013444305   297 NECTALAAEVDAAIKKYAIVNHPKYGKIYAFEVDGYGNYLMMDDANVPSLLSLPYLGYTSINDPVYKNTRKFVWSNDNPY 376 Paludibacter ...
CDD32467       304 NQTERLKKEVDEAIQKYGIVNHPVFGKIYAYEVDGYGGCNLMDDANNPSLLSVPYFGYVNADDPVYQNTRKFVWSKHNPY 383 Bacteroides s...
CDD32914       297 QECLQLADEVDEAIKKYGVVNHPVAGRIYAFEVDGYGNSLCMDDANVPSLLGAPYLGYCSQDDPLYLNTRKFIWSDNNPY 376 Bacteroides s...
WP_013545726   306 AECIALSDEVDSAIRKYGTFNHPVCGRIYAFEVDGFGNALCMDDANVPSLLAAPYLGYCSCKDAIYQNTRKMIWSDNNPY 385 Bacteroides h...
WP_012788743   299 KECTELADEVDRAIKAYAIVEHPQLGHMYPLEVDGYGNRLFLDDTNVPSLLSIPYLGYTTADDPLYQNSRHFVWSTFHCW 378 Chitinophaga ...
jgi:Solca_2730 299 TKCTNLANEVEAAVDKYGIVDHQKYGKVYAFEVDGFGNYVCMDDANVPSLLALPYLGCCAKNENIYINTRNMVWSEYNPY 378 Solitalea can...
WP_038559350   302 KECLALSKEVDAAIKEYAIVEHKKYGKVYAFEVDGFGNHTFMDDANVPSLLALPYLGLLEKEDKIYQNTRKLVWSEDNPY 381 Draconibacter...
WP_008780859   314 GRCEALAGEVEEAVKKYAIVEHPEFGKVYAFEVDGYGSRVFMDDANVPSLLALPFLGCVDVNDPIYQNTRRLVLSPSNPY 393 Bacteroidales
WP_021988424   312 AECKALAAEVQTAINRYAIVTHPKYGKVYAYETDGFGNHYFMDDANVPSLLAMPYLGTISVKDPVYQNTRRMVWSNDNPF 391 Culturomica m...
5M7Y_A         337 FFEGKAAKGIGSPHTPDQYIWHIALSMQGLTTNNQEEIDQLIKLLKETDAGTGYMHEGFHVDDPTKFTRDWFAWSNSLFS 416 Clostridium p...
WP_013444305   377 FYKGKAGEGIGGPHVGVDMIWPMSIIMKALTSNNPEEIAACLKTLKQTHAGTGFMHETFHKNDPANFTRSWFAWANTLFG 456 Paludibacter ...
CDD32467       384 FFKGTVAEGIGGPHCGKDKIWPMSIISKALTSEDKEEIAECLRVLVNTDGNTGFIHESFHKDNPADFSRGWFAWANTLFA 463 Bacteroides s...
CDD32914       377 FFKGKAGEGVGGPHVGLDYAWPMSIIMKALTSTDKEEIRRCVTLLKNTDADTGFMHESFHVDDPTKFTRSWFAWTNTLFG 456 Bacteroides s...
WP_013545726   386 FFKGKAGEGVGGPHVGLDHIWPMSIIMKAFTTDDVQEIRACLKQLRDTDGGTGFMHESFHSENAGKFTRSWFAWVNTLFG 465 Bacteroides h...
WP_012788743   379 FYKGKYGDGVGSPHTGPDYIWPMSIIMKALTSSNPDEIAECIKTLRNTDGDTGFIHESYHKDDPTKYTRKWFAWANTLFG 458 Chitinophaga ...
jgi:Solca_2730 379 FFKGKAAEGIGGPHVGLDYIWPMSIIMRAFTSSSDEEIRNCIKVLRDTDGDTGFMHESFHKDDPAKFTRKWFAWANTLFG 458 Solitalea can...
WP_038559350   382 FFKGKAAEGIGGPHVGYDMVWPMSIIMRAMTSSDDKEIAWCIKTLRNTDADTGFMHETFHKDDPTNFTRSWFAWANTLFG 461 Draconibacter...
WP_008780859   394 FFKGKAGEGIGGPHIGFNYIWPMSLIMRATTSNDEKEIRYCIETLRDTDGGTGFMHESFHKDNPSDYTRSWFAWTNTLFG 473 Bacteroidales
WP_021988424   392 FFKGTAAEGIGGPHIGYDMIWPMSIIMKAMTSTDDGEIRKCIRTLRDTDAGTGFMHESFHMNKPEKFSRSWFAWANTLFG 471 Culturomica m...
5M7Y_A         417 HFIY 420 Clostridium perfringens str. 13
WP_013444305   457 ELLI 460 Paludibacter propionicigenes
CDD32467       464 ELVL 467 Bacteroides sp. CAG:714
CDD32914       457 ELIV 460 Bacteroides sp. CAG:714
WP_013545726   466 ELIL 469 Bacteroides helcogenes
WP_012788743   459 ELIL 462 Chitinophaga pinensis
jgi:Solca_2730 459 ELII 462 Solitalea canadensis DSM 3403
WP_038559350   462 ELVL 465 Draconibacterium orientale
WP_008780859   474 ELIV 477 Bacteroidales
WP_021988424   472 ELIV 475 Culturomica massiliensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap