Conserved Protein Domain Family
DUF1233

?
pfam06806: DUF1233 
Putative excisionase (DUF1233)
This family consists of several putative phage excisionase proteins of around 80 residues in length.
Statistics
?
PSSM-Id: 399649
View PSSM: pfam06806
Aligned: 6 rows
Threshold Bit Score: 103.305
Threshold Setting Gi: 386924226
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6LSL1              13 IITLPQSKWVGENIIQAVYGLTGAAIMNYRLKAWQQGVHYRKVGITGVPSgSKAKILYNIHSINEWIDAYP 83  Photobacterium pro...
CAL20722             4 VIQMNPSKWVSEDLLMSLNGMTKHMIQHARRKSWMEGREYIHVAPDLNPK-ENSPIMYNRQEIDNWVERQR 73  Yersinia pestis CO92
WP_002440473         6 yiiADPGEWVSEEQIMALKGLKEGTLKNARKKSFLEGREYKHVAADGEPY-DNSPCFYNIPAIDRWIARQA 75  Shimwellia blattae
goetting:EBL_c20890  2 vqIIFHEEWVVQNKLTEKTGLSARQIKACRLGSWIEGVHFKRLSPSGLKT-LRGVVWYNYPKINQLVQds- 70  Shimwellia blattae...
Q8ZQI8               5 IYQIAPNDWVTDEVLMASTGLKPGTILRARKKAWFVGREYKHMTLDGKPK-ANGECLYHLPTINRWIRNMP 74  Salmonella enteric...
Q1G0L5               4 IIQLTPNKWVSEKVLIAVTGLKPGTITRARKESWMLGREYLHISPDGNPK-PSSECIYNREAVDQWIEAQK 73  Salmonella enteric...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap