3WRY


Conserved Protein Domain Family
UPF0261

?
pfam06792: UPF0261 
Uncharacterized protein family (UPF0261)
Statistics
?
PSSM-Id: 399642
Aligned: 129 rows
Threshold Bit Score: 418.039
Threshold Setting Gi: 524642510
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3WRY_A        10 RVFCIGTADTKFDELRFLSEHVRSSLnsfsnkssfkVGVTVVDVSTSWKeTN---SCAdfdfVPSKDVLSCHtlGEEtmG 86 
WP_021870914   4 TIALIASLDTKKKETLYAASVIQKQG----------FSTYIIDISTKNLvD----GAD----ITPVEILKRY--GI---E 60  unclassified Cl...
WP_055193605   3 TIAVIESCDTKFKEAKFISDFIKNEG----------LNALVINTATGPApSY---NYD----ISREEIAESY--GT---P 60  Dorea longicatena
WP_014271006   3 IIAVIASFDTKYHEVAYVQQQIEELG----------CTPFLIDISTGPNpPLiaiTAD----IPRDDVLRMG--GS---S 63  Sphaerochaeta p...
CDD57060       3 VVGVIASCDTKYHEVQFVQKKIKMSG----------NSPLILDVSTGPHiPM---RAD----VSREEILAVG--GY---T 60  Clostridium sp....
Q2YJD2         9 RILVIGTGDTKSDELLFMADVIERAG----------GSPVMIDVSILGNpPY---EPA----YSKHDVAEAA--GTT--V 67  Brucella abortu...
Q1GKY7         6 TILVAGTWDTKDDELSYLSEVIRGQG----------GQVLSMDVSVLGEpKL---PTD----VSKHDVAEAA--GSS--I 64  Ruegeria sp. TM...
Q28LI9         5 TILVIGTYDTKDAELGFLADVIRDQG----------GRVLTMDVSVLGApSM---PCD----LSKHDVAEEG--GSS--I 63  Jannaschia sp. ...
Q39TT5        11 KVLLIAAMDTKGTEARYIESWLAKAG----------FTTLIMDMGIRGKrPG---PVA----VTRDEVLRAA--GKT--W 69  Geobacter metal...
Q5P8S0         6 KVLLVATRDTKNEESQYIRQCLEDAG----------VEVYHLDASIRSTlDG---DVA----IGPDKIAGAA--GMT--M 64  Aromatoleum aro...
3WRY_A        87 T--FADT-RGLAIAIMSKALETFLSIAN-DEQ-------------NLAGViglggsggtsllssAFRSLPIGIPKVIIST 149
WP_021870914  61 WedFDPLgKAASIDVMSKAAAFVLPQLYaEGKfdvvisigggqnaKMAAM--------------AMKTLPFAVPKIVASS 126 unclassified Cl...
WP_055193605  61 WkeMEPKsKGEKIDYMKDAVAAYVVKLYeEGKidgiisvgglqntVMAAN--------------AMQKLPIGFPKVMATT 126 Dorea longicatena
WP_014271006  64 WetIKKLdKGNAIKSMSDCVSKVIYTLHsERKidgvlgmgglqntIICSA--------------ALRQLPLGFPKFICST 129 Sphaerochaeta p...
CDD57060      61 WeqVHAMdKSGAIAAMTESISKMLLKLVeEKKidgvmgmgglqntVMCSA--------------ALRLLPIGFPKIICST 126 Clostridium sp....
Q2YJD2        68 QaiIDSGdEHSAMALMAEGATALVRGLSqRGQvdgmialggslgtDLALD--------------IAAILPLGVPKFIVST 133 Brucella abortu...
Q1GKY7        65 QraIDSGdENTAMQIMGAGSARLALDLWrAGRihgvivlggtmgtDLALD--------------LCAALPLGVPKYVVST 130 Ruegeria sp. TM...
Q28LI9        64 EaaIASGdENTAMQIMARGASLLVARLYaEGRfdgmvvlggtmgtDLALD--------------VCTALPLGVPKYIVST 129 Jannaschia sp. ...
Q39TT5        70 DdiQNVTsEGDAVDIMISGGVKCALALYkADLiqgvislggtmgtTLGTG--------------VMRAFPIGFPKVMIST 135 Geobacter metal...
Q5P8S0        65 PeiRALRhEGLCLEVMIRGALKCADELNrNVGlsgilglggsmgtVLATR--------------IMQTFPYGLPKVMIST 130 Aromatoleum aro...
3WRY_A       150 VAS--GQTESYIG----TSDLVLFPSVVDICGINNVSKVVLSNAGAAFAGMVIGRLESskehsitNGKFTVGVTMFGVTT 223
WP_021870914 127 LACgsRTMEQYVG----DKDIFVMHTVADISGLNSITKTVIQSVCSAAMGLAEYAKTFps----eEGKKVLGATELGVTS 198 unclassified Cl...
WP_055193605 127 VASgtRKFDLVVG----DKDITVMPAICDFTGLNIVTRQVISNACACCVGMVKCAGQVlt----kGDKPVVAVTLMGVTN 198 Dorea longicatena
WP_014271006 130 IASgnRYFDTVVG----DKDITVMPSIVDFAGINPISEVVLANSVASVVGMVKYGKHEid----tHGKHYIGATLMGITN 201 Sphaerochaeta p...
CDD57060     127 IASgyRYFDTVVG----DKDIMVVPSIVDFAGMNPVNEAVLGNTVSALIGMVTYGGKRid----tHGEKYIATTLMGITN 198 Clostridium sp....
Q2YJD2       134 IAY-----SHLLPperiAPDLMMILWAGGLYGLNPICRSVLSQACGAVVGAAKLVEkp------sAEKPLIGMTSLGSSC 202 Brucella abortu...
Q1GKY7       131 VAF-----SPLLPperiPADLQMILWAGGLYGLNDICKASLSQAAGAVLGAARAVEap------sFERPMVGMTSFGKTV 199 Ruegeria sp. TM...
Q28LI9       130 VSF-----SPLIPaerlAADTQMILWAGGLYGLNSVCKASLSQAAGAVLGAARAVQkp------dPDKPLIGMMSLGTSA 198 Jannaschia sp. ...
Q39TT5       136 IAA--KDTEAFIG----NMDIFMLNSVSDLAGLNRITRKVLRNGALAIAGLVREREFhd-----eFSRPLAVLTTLGTTE 204 Geobacter metal...
Q5P8S0       131 MAS--GMTGPFVG----AKDIMMVNPVCDISGLNSITRNAFRSGALAVAAMAHDYQSGea----gGNKPLITVSTLGTTE 200 Aromatoleum aro...
3WRY_A       224 -PCVNAVKERLVKEG-YETLVFHATGVGGRAMEDLVRGGFIQGVLDITTTEVADYVVGGV-MACDSS---RFDAILEKKI 297
WP_021870914 199 -KGTENALHMIEESGlFENVVFHANGVGGRCMENLMREGRIDVALDMTLHEITCETIGGY-CVGAND---RLMTAVEHKI 273 unclassified Cl...
WP_055193605 199 -TGAVAAVEELEKMG-LEVIGFHATGVGGATMEDMAANGLVDGILDLTLHELTSEYFGGG-FSYGPKakiRLVESVEKKV 275 Dorea longicatena
WP_014271006 202 -DTVMRAINNLTVKG-ENVISFHSTGIGGRVLDSQIRDGNIAAVMDLCLHEMTAEYFGGLgYSKGANn--RLLAAAEMGI 277 Sphaerochaeta p...
CDD57060     199 -DTVMRASDELTALG-RKMISFHSTGIGGRVMESMIREGVISAVMDLSLHEMTAEYLGDYgYSKGADn--RLCAAAEMGI 274 Clostridium sp....
Q2YJD2       203 lKYMRFLKPELEKRG-YDVAIFHATGMGGRAYEAVAAQKGFVAVFDFCIQEVTNAESGSV-VTSGPD---RMENAGRAGI 277 Brucella abortu...
Q1GKY7       200 lRYMVTLKPELEKRG-FDVAVFHATGMGGRAFESLAGEGAFAAVMDFAPQEVSNHLFGG--LSAGEG---RMTHAGHAGV 273 Ruegeria sp. TM...
Q28LI9       199 lKYVIPLKPALEERG-YEVAVFHATGMGGRAFESLAAQGAFACVFDFCTQELGNHIHGSN-ISAGAD---RLTNAGASGT 273 Jannaschia sp. ...
Q39TT5       205 -ATAARMRIHFEAWG-YESVTFHTTGTGGQAMERMVNFEPVSAVVDLSLHELIDHHFGGA-FDPGPE---RGRAALQKGI 278 Geobacter metal...
Q5P8S0       201 -KCSARVRRSLEQQG-FEVMVFHTLGTGGAAMEQIIRERDVAVVIDMSLIEVSEYLHGGL-CATGPD---RGKAALEKGV 274 Aromatoleum aro...
3WRY_A       298 PLVLSVGALDMVNF---GPKTTIPPEFQQRKIHEHNEQ-VSLMRTTVGENKKFAAFIAEKLNKASSSVCVCLPEKGVSAL 373
WP_021870914 274 PMVVVPGALDMVDYfinEQGEGLPDDIDQRKKVYHNSS-ICHCKIYKEEAEKIVDVVCSRLNQAVSPVTLVIPAKGCCEA 352 unclassified Cl...
WP_055193605 276 PLVISLGGLDFVDF---STSE-LPDRMDERKYMLHNAN-TAHIKILPEEAEALGKILAERLSKVTYPVKLLIPTKGMRHN 350 Dorea longicatena
WP_014271006 278 PSLICPGGIDFACL---SKEDFFDDEDK-RGFVWHSKDyLTHTRLWESEILDITRTIIQRVNCAKGITEIVLPLGGLRTM 353 Sphaerochaeta p...
CDD57060     275 PALICPGGIDFACL---RKEELLKDEEE-RGYVWHNQD-LTHTRLYESEILDITHTIVERLNRSKGKTEVILPMGGLRTM 349 Clostridium sp....
Q2YJD2       278 PQIIAPGAVDMVDM---PAWQNVPEQFRDRPYHAHNRL-IASITVSPEQRRAVARVVAAKLERAAAPVAFILPTGGVQEW 353 Brucella abortu...
Q1GKY7       274 PQLIAPGCYDLVDF---VGWQGAPEQLRGRECHAHNRL-LTSAMLDARERQRVAQEMCNKLARASAPVTVFLPRAGCNEW 349 Ruegeria sp. TM...
Q28LI9       274 PQIVAPGCYDLVDI---VGWQPVPEKWTDHLSHAHNRL-LTSIVLNTEERREVARAHAVQLATAKGATAVILPRHGLGEW 349 Jannaschia sp. ...
Q39TT5       279 PTVIVPGNIDFLVT---GPMAQAQIYFPGRRGHKHNAN-ITCVRTSLEEIQRIAEIMAGYCNESTGPVAVLVPMKGFSCL 354 Geobacter metal...
Q5P8S0       275 PTIFAPGNLDFLVA---GPLAEAKVRFPGRRYHEHNPA-LTAVRAEAQEFRNDAEHLAGLIRTARGPVSFFVPLQGFSNH 350 Aromatoleum aro...
3WRY_A       374 DAPGKDFYDPEATSCLTRELQMLLENNeRcQVKVLPYHINDAEFANALVDSFLEI 428
WP_021870914 353 AAPGGPMYDPEVDEVMVDAFKKKIGNN-V-KLVIVDANINEKAFSETVAHEVLll 405 unclassified Clostridium
WP_055193605 351 TLEGQELYEPKSDSVLIQTIIENVNDN-V-EVIVIPHNLDTPEFGVKAAHYIVDE 403 Dorea longicatena
WP_014271006 354 SRPGEFFFKPDTIKKMKVIFDEELKPE-I-VCKAFDLNFDDPDFADICANEMLAL 406 Sphaerochaeta pleomorpha
CDD57060     350 SYPGEFFYKPETMQKMRQIFEADLKPE-I-VFKAYDLNFCDPEFADICAQEMEAL 402 Clostridium sp. CAG:43
Q2YJD2       354 DRNGEPLHEPEALGAFLDEMRGAVSGT-I-TFEEVDAHINAPEFASRALAVFDRW 406 Brucella abortus 2308
Q1GKY7       350 DRAGGDLHDAEGLRAFCDEMRRGVPEN-A-QLQELDCHINDAEFTNAVLAQFDAW 402 Ruegeria sp. TM1040
Q28LI9       350 DREGADLHDQEGLNAFLAELSRALPAN-V-QAHAIDAHINDALFADTALTIFDQW 402 Jannaschia sp. CCS1
Q39TT5       355 DHEDGPQPDPEGPRVFAETFARALTRT-I-HFETVPLHINDEAFSEVIVGALQKI 407 Geobacter metallireducens GS-15
Q5P8S0       351 DSPDGHLHDPSLPPVFLAHLKTVMPAG-V-PVVELPLHINDEKFADALVEQAVAf 403 Aromatoleum aromaticum EbN1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap