Conserved Protein Domain Family
TMP_2

?
pfam06791: TMP_2 
Prophage tail length tape measure protein
This family represents a conserved region located towards the N-terminal end of prophage tail length tape measure protein (TMP). TMP is important for assembly of phage tails and involved in tail length determination. Mutated forms TMP cause tail fibers to be shortened.
Statistics
?
PSSM-Id: 399641
Aligned: 32 rows
Threshold Bit Score: 133.228
Threshold Setting Gi: 357937124
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015930595    212 TDASGKAAKLSAYELQNLGYQANDVFSSLASGI--SPMQTLAQQGPQIYQIMagsqG---GLKGAITGIGSSAMGALRSV 286  Methylobact...
WP_014891135    146 TNDNVKAVGLARHEWTNFGRQVQDVVTMGLGGA--SPLQIASTQGAQFFDIFtsssA---GASAALKDVGGVALRLVLnp 220  Methylocyst...
jgi:Xaut_3717   291 lnGVAKGAGLAGYQMMNLSRQMNDVATMALMGA--SPFQIITSQAGQVYQVLqegqG---GVTGSLKYLGERLMGLVTPA 365  Xanthobacte...
WP_015931522    316 TEAAGQGARLTAFDLQNLGYQANDVFSSLASGI--SPMQTLAQQGPQIYQILagsqG---GLTGGLQAVRDAALSMVRGI 390  Methylobact...
Q3SUH9          165 ITGVGGSSKLTRNQLLTLQYTFNDVVASMSTGM--SPMTILMQQGGQVTQAF----G---GLRGTLTAFG-------SAL 228  Nitrobacter...
jgi:Bresu_0071  172 MSRQAVASRL------NLARQGADVAVTAAMGM--NPAMIAIQQGPQILDALatsgF---KASAGLIAAGaaa------- 233  Brevundimon...
Q4KA79          223 itATEGAFDKLKLGTRQAQENVMQLTNALQSGDwgSGARAIAQLGA--------------GAGASAKSL----AAALIPA 284  Pseudomonas...
Q8ZQ86          194 LDTATKSTHALGLKSAMARREIGVLIGELARGN------------------F----GalrGSGITLANRAGWIEQLMSPK 251  Salmonella ...
Q8ZQG3          229 MENAGTVTRSLGLKSAAARREIGVLFGELARGN------------------F----GalrGSGITLANRAGWLETLMSPK 286  Salmonella ...
jgi:Bphy_7153    64 AEEAAKSIEKVGHTSVAARRELLVLAHELSQGN---------------YKRF----G---GSLMVLGEQMDWMGKIMSPV 121  Paraburkhol...
WP_015930595    287 GLLggal-gamGVAAVTATAAALSYGSSMRETDRLLAGMGRASGVSAGQVTAAGEAIAAASEvSRREARTMAATFASTGK 365  Methylobact...
WP_014891135    221 v-------taiAAAAGTAALAMFRWKEQTDALTFSLNGLGRQSGMTVSQVNRIAEAGAAGAGiSNASARGLAGQFLSAGV 293  Methylocyst...
jgi:Xaut_3717   366 Ravv----aglAGIGIAAGLAYSSYLDGQYQLQRSLQGLGGSTNATVSQLEAIAEAGAAASKiSVSASRDLTAAFASTGK 441  Xanthobacte...
WP_015931522    391 GLVggai-gglTATALTGLIAWRSYASTQREVQQALVGLGRGAGTSVDQINRIASASAEAGGvSVREARSMAATFASTGR 469  Methylobact...
Q3SUH9          229 GVVgava-igvAAAVVGLTAAWVANDASTRSVTTALMGIGRASGTTASELERVAQSSAEAGKiSVRSAREMEVAFLRTGK 307  Nitrobacter...
jgi:Bresu_0071  234 --------talAGGVALLGAAWLEGEDAALAYERAVTGIGRTADLSAAELEALTVTAAEQGEvSEKAARQQATAYLATGR 305  Brevundimon...
Q4KA79          285 GLL--------AGVIGGLGYAYFDAMKQAREFNSVINGGSNDAGQSVASLKSMSDSAGTLTG-NLTGAREAVIALASGAA 355  Pseudomonas...
Q8ZQ86          252 GMMlgglvggvAAAVYGLGKAYYEGAKESEEFNKQLILTGSYAGKTTGKLNEMAKSLAGNGV-TQHDAAGVLTQVVGSGA 330  Salmonella ...
Q8ZQG3          287 GLAvggtvtaiAAAVYGLGKAWYSGTKEGEEFNKQLILTGNYAGKTAGQLQQMARSIAGNGI-TQHDAAGILAQVVGSGA 365  Salmonella ...
jgi:Bphy_7153   122 GLAvg----alTATLGGLAYAAVKGAEQQAAFGRAVQVTGNYAGMTESRFEAMTKSVAENSGmTVSAARDITQALLDTGR 197  Paraburkhol...
WP_015930595    366 IGADMLVGLGKTAKDFAATTGQELPDAYKELAQAFADPARGAETLNEKLGFLNARTRENIQ 426  Methylobacterium nodulans
WP_014891135    294 PGGS-LQGAISAARGLSRGLGVDLDDAGKELAAALAEPVKGADDLARKYGIVSFAEREHIK 353  Methylocystis sp. SC2
jgi:Xaut_3717   442 IGKETYTGLIEVTTRYAALTQKDLAEAGADLASAFADPAKGAQDLDQKLNFLNVETLRYIR 502  Xanthobacter autotrophicus Py2
WP_015931522    470 IGASMYADLISRTRDYAATTGQELPDAAKELAQAFADPSRGVQILDERLGGLNDRTAQTIr 530  Methylobacterium nodulans
Q3SUH9          308 IGAEEMARAISIARNFAVTMGVETKAGAEQLASALTDPVRGADELNSRLAFLDDRTRQYIR 368  Nitrobacter winogradskyi Nb-255
jgi:Bresu_0071  306 IGGEVIGGLIRIGKDYASVMGLDAEAATQSLARAMVEPDKAGRELTRTMGLLDQAQLRQID 366  Brevundimonas subvibrioides AT...
Q4KA79          356 TSGVQMQNLAEAAAAIGEVTGKGAGDIAKSLANAGNTATEAASKISDQYGLLTYEQYQVIK 416  Pseudomonas protegens Pf-5
Q8ZQ86          331 FTGQAVAMVSRTAARMQENVGQSVDETIRQFKRLQDDPVNAAKELDRALHFLTATQLEQIR 391  Salmonella enterica subsp. ent...
Q8ZQG3          366 FGSTDLSRVANAAARLKQATGQDISETISQFKKLKDDPVNAVVALNDSLHFLTATQYQQIS 426  Salmonella enterica subsp. ent...
jgi:Bphy_7153   198 FGPASLEAVSNAAATMQHLTGQKVEEVVKDFAKMSDGALKWALEADKQYHFVTGALFDQVK 258  Paraburkholderia phymatum STM815
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap