Conserved Protein Domain Family
UPF0258

?
pfam06789: UPF0258 
Uncharacterized protein family (UPF0258)
Statistics
?
PSSM-Id: 429119
Aligned: 6 rows
Threshold Bit Score: 207.375
Threshold Setting Gi: 0
Created: 27-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_008101322  47 QWHNRVYSQKEKKNVREQPVVQLGELHP---AMIDKALGKHITPVTLKSTIKSNPLYNDVFIDDTWQE-RRNNPSWTVQD 122 green anole
2_pfamImport   1 KWHNKVYSQREKKRITDTPTTEVSESGP---LPFDKSLSKHITPVTLTSKIKRNPLYSNIRIVDGWEE-KTPNPSWTIQE 76 
XP_007237291 741 ERHRK---SKETDRQYDAHQAHRSSKPPkdsYLVEQVFSPHHFPPSVKSHVKGSPLYTDLRLAGVPDG-KRPQPSWTIEE 816 Mexican tetra
Q8K3V7       760 DWHRK---SKEADRQYDIPPQHRLPKQPkdgFLVEQVFSPHPYPTSLKGHMKSNPLYTDMRLTELAEV-KRGQPSWTIEE 835 house mouse
1_pfamImport   1 QWQNRVYLQREKRNLNDSYGWKSTEGSP---VLVDKSLGKHITPVTLKSKIKRNPLYSDIRTVDGWES-KKTQPSWTIQE 76 
3_pfamImport   1 RWQNRVYLQ----VWNNRATITLQHGSPv--VLVDRYLEKHITPVTLKYNIKRNPLYMDLKSIDTVDSgGRFKPSWTIKE 74 
XP_008101322 123 YDRHSLNSTLARYLK---------------------------ENPNDIHYWLEDIYTPGYDTLLKKKERESKRSRCCLII 175 green anole
2_pfamImport  77 YDRHSVHHNLANYLKvrhmfyikcfagpalpqsplplnrvskEDPNDLKFWLEDIYTPGYDSLLKKKENEMKKSKLCKIT 156
XP_007237291 817 FKRNS--GDKSK-LSaldlq------------------tqesLNPNNLEYWMEDIYTPGYDSLLKRKEAEFRRAKVCKIG 875 Mexican tetra
Q8K3V7       836 YARNS--GDKGK-LTaldlq------------------tqesLNPNNLEYWMEDIYTPGYDSLLKRKEAEFRRAKVCKIA 894 house mouse
1_pfamImport  77 YDRHSLHSNLAGYLKh-------------------------sEDPSNLSFWMEDLYTPGYDSLLKKKENELKRNKICKII 131
3_pfamImport  75 YDTKTIHGNL-DYLK-------------------------------ELDFWLEDLYTPGFDSLLKRKEAEHKRKRLSKIV 122
XP_008101322 176 LFLVLLVCITTATVIVCI 193 green anole
2_pfamImport 157 LLVLFTICGLVVVIIVPV 174
XP_007237291 876 ALIAAAACTVILVIVVPI 893 Mexican tetra
Q8K3V7       895 ALITAAACTVILVIVVPI 912 house mouse
1_pfamImport 132 TLISVLICIFIVIVTVPI 149
3_pfamImport 123 LSIILLICASLIVIIVPI 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap