Conserved Protein Domain Family
UPF0258

?
pfam06789: UPF0258 
Uncharacterized protein family (UPF0258)
Statistics
?
PSSM-Id: 399640
View PSSM: pfam06789
Aligned: 6 rows
Threshold Bit Score: 205.052
Threshold Setting Gi: 1570591126
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_008101322  47 QWHNRVYSQKEKKNVREQPVVQLGE---------------------LHP---AMIDKALGKHITPVTLKSTIKSNPLYND 102 green anole
2_pfamImport   1 KWHNKVYSQREKKRITDTPTTEVSE---------------------SGP---LPFDKSLSKHITPVTLTSKIKRNPLYSN 56 
XP_007237291 741 ERHRK---SKETDRQYDAHQAHRSS---------------------KPPkdsYLVEQVFSPHHFPPSVKSHVKGSPLYTD 796 Mexican tetra
Q8K3V7       760 DWHRK---SKEADRQYDIPPQHRLP---------------------KQPkdgFLVEQVFSPHPYPTSLKGHMKSNPLYTD 815 house mouse
XP_027881861  41 RWQNRVYLQ----VWSNRATITLQHalsaqreqttqhgrkippyseGSPv--VLVDRYLEKHITPVTLKYNIKRNPLYMD 114 Monterrey platy...
XP_006626987  45 QWQNRVYLQREKRNLNDSYGWKSTE---------------------GSP---VLVDKSLGKHITPVTLKSKIKRNPLYSD 100 spotted gar
XP_008101322 103 VFIDDTWQE-RRNNPSWTVQDYDRHSLNSTLARYL------K---------------------------ENPNDIHYWLE 148 green anole
2_pfamImport  57 IRIVDGWEE-KTPNPSWTIQEYDRHSVHHNLANYL------KvrhmfyikcfagpalpqsplplnrvskEDPNDLKFWLE 129
XP_007237291 797 LRLAGVPDG-KRPQPSWTIEEFKRNS--GDKSK-L------Saldlq------------------tqesLNPNNLEYWME 848 Mexican tetra
Q8K3V7       816 MRLTELAEV-KRGQPSWTIEEYARNS--GDKGK-L------Taldlq------------------tqesLNPNNLEYWME 867 house mouse
XP_027881861 115 LKSIDTVDSgGRFKPSWTIKEYDTKTIHGNL-DYLkdtktpK-------------------------------ELDFWLE 162 Monterrey platy...
XP_006626987 101 IRTVDGWES-KKTQPSWTIQEYDRHSLHSNLAGYL------K---------------------------EDPSNLSFWME 146 spotted gar
XP_008101322 149 DIYTPGYDTLLKKKERESKRSRCCLIILFLVLLVCITTATVIVCI 193 green anole
2_pfamImport 130 DIYTPGYDSLLKKKENEMKKSKLCKITLLVLFTICGLVVVIIVPV 174
XP_007237291 849 DIYTPGYDSLLKRKEAEFRRAKVCKIGALIAAAACTVILVIVVPI 893 Mexican tetra
Q8K3V7       868 DIYTPGYDSLLKRKEAEFRRAKVCKIAALITAAACTVILVIVVPI 912 house mouse
XP_027881861 163 DLYTPGFDSLLKRKEAEHKRKRLSKIVLSIILLICASLIVIIVPI 207 Monterrey platyfish
XP_006626987 147 DLYTPGYDSLLKKKENELKRNKICKIITLISVLICIFIVIVTVPI 191 spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap