Conserved Protein Domain Family
UPF0257

?
pfam06788: UPF0257 
Uncharacterized protein family (UPF0257)
Statistics
?
PSSM-Id: 399639
Aligned: 5 rows
Threshold Bit Score: 364.566
Threshold Setting Gi: 306527024
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
IEC:ABF-0016410   2 KLRATLLAGSVLLAGCDLKPAAEPVNPVLAGLSNVFGFDALRGKVKRFTQTQIDDAGKVTAYVEGEFDAEGCLAALRTYQ 81  Dickeya dada...
Q8ZPJ4            2 KKPLLLTLLCMILAGCDNPKSLESFTPEMASFSNEFDFDPLRGPVKDFSQTLMSENGEVAKQVTGTLSQEGCFDTLELHD 81  Salmonella e...
wugsc:CKO_01579  14 KKQTLVSFLCVLLVGCDNATVLVSFTPEMASFSNEFDFDPLRGPVKDFSQTLMNDKGEVTKRISGTLSQEGCFDTLELHD 93  Citrobacter ...
P67553            2 KYKLLPCLLAIFLTGCDRTEVTLSFTPEMASFSNEFDFDPLRGPVKDFTQTLMDEQGEVTKRVSGTLSEEGCFDSLELLD 81  Escherichia ...
wugsc:KPN_01582   1 --mywlipAALLLTACDRKSAPDAFTPEMASFSNEFEFDPLRGPVKDFSQTLLDEHDVVVKKVSAQLSREGCFDLLTLED 78  Klebsiella p...
IEC:ABF-0016410  82 PSMNLDLDLVRNGQMLVEQSDRQALFQLTDHCQLANTNDGRLSYRSNDKyaiAEVVYRDKPTPLASYRYDDDGFPVSMTF 161 Dickeya dada...
Q8ZPJ4           82 LENNTGLALVLDANYYRDAQTLEKKVQLQGKCQLAALPSAGVTWETDDN---GFVVSATGKEMKVEYRYDSEGYPLGKTT 158 Salmonella e...
wugsc:CKO_01579  94 LENNTGLALVLDANYYRDAETMEKRVRLQGKCQLAELPSAGVVWDTDDN---GFVVSATGRETKVQYRYDAEGYPLGKTT 170 Citrobacter ...
P67553           82 LENNTVVALVLDANYYRDAETLEKRVRLQGKCQLAELPSAGVSWETDDN---GFVIKASSKQMQMEYRYDDQGYPLGKTT 158 Escherichia ...
wugsc:KPN_01582  79 VENKTGATLLLDANYYVDGRTHEKRLRLQGKCQLAEMPAAGVSWETDDN---GFIISARGKETTATYRYDSDGYPLGKTT 155 Klebsiella p...
IEC:ABF-0016410 162 VSPEngKVTKVEMRNDAPAQKRLDATVVVTENDEQVSVTRTSCQYDQHFNPRLCQVLVSNGKGAAQTVTTLTHTTKIEYY 241 Dickeya dada...
Q8ZPJ4          159 INSQ--NTLSVTAKPSADPRKKLDYTAVSRVDDRQVGNVTQSCEYDAYANPVDCRLVIVDESVKPAVSHHYTIKNRIDYY 236 Salmonella e...
wugsc:CKO_01579 171 ISKD--KTLSIDAKPSADPLKKLDYTAVSLLNDRPLGNVKQTCEYDNYANPINCQLVIVDESVEPAVARSYTIKNTIDYY 248 Citrobacter ...
P67553          159 KSND--KTLSVSATPSTDPIKKLDYTAVTLLNNQRVGNVKQSCEYDSHANPVDCQLIIVDEGVKPAVERVYTIKNTIDYY 236 Escherichia ...
wugsc:KPN_01582 156 TAKE--ERFTVASTPSKDPRKKLDYTAISTFNDRTLGTVRQTCDYDDHDNPLSCELQVIDESVQPPLTRHYTIKNRIDYY 233 Klebsiella p...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap