Conserved Protein Domain Family
MFS_4

?
pfam06779: MFS_4 
Uncharacterized MFS-type transporter YbfB
This family represents putative bacterial membrane proteins which may be sugar transporters. Members carry twelve transmembrane regions which are characteristic of members of the major facilitator sugar-transporter superfamily.
Statistics
?
PSSM-Id: 399632
Aligned: 10 rows
Threshold Bit Score: 271.551
Threshold Setting Gi: 81735933
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010972214  23 MASAMGFGRFSFTPILPGMMADVPLSAGDAGIVAAGNFAGYLAGAILAASSWGSGRERLV----ALCGLFSTAALLLAMA 98  Agrobacterium t...
Q92UK2         1 MAVAMGFGRFSYTPILPAMMTDTGLSPADAGLVASANFIGYLAGAVLAGYRWAHGRERGV----GLAALVATTLLLAAMG 76  Sinorhizobium m...
Q8Y185        36 LSVAMGIGRFAFTPILPMMLHDGSVTLGQGSWLATLNYLGYFVGAL-ACMALRGDAARL-----IRIGLVATVLLTAGMG 109 Ralstonia solan...
Q88ED9        14 LMMAMGIGRFALTPQLPQLIAEGQFDLTVAGLVAAANYLGYFVGAVDAMFARSPGQVRRR----LHGGLWLCVLLTLASW 89  Pseudomonas put...
Q9I3T2        20 LVVAMGVGRFSLTPQLPHLIREGQLDLTGAGLLAAANYLGYLVGALDALFAREARQARLR----LLVGLWACFGLTLASV 95  Pseudomonas aer...
Q9PGN0        26 LSLGIGIGRFLHTPILPVMLREGQFTFSQLSYIASANYAGYLLGSLFFSFGKLGNTSRTTm--mLYGAAIVTNVLIFAMA 103 Xylella fastidiosa
P39381        23 LTLGMGLGRFLYTPMLPVMMAEGSFSFSQLSWIASGNYAGYLAGSLLFSFGAFHQPSRLRp--fLLASALASGLLILAMA 100 Escherichia col...
Q8ZJZ6        23 LTLGMGVGRFLYTPMLPVMLAEKQLTFNQLSWIASANYAGYLAGSLLFSFGLFHLPSRLRp--mLLASAVATGILILAMA 100 Salmonella ente...
Q89HQ1        48 SLVGLGLARFSYTPLIPALIAAKWFSASDVVYLGAANLAGYLAGALAA----RAVATRVGavgaLRAMMLLATLSFFASS 123 Bradyrhizobium ...
Q89X18        63 ATVGLGIGRFAYALVLPDMRETLGWSYSAAGFMNTINAVGYLVGALVA----SRLIQRVGwsaaIRGGTLACVAALATCA 138 Bradyrhizobium ...
WP_010972214  99 AFNSVAAFTVIRFLAGVASAMTMIFTSQIV--IGHAAKAGRDSVQALHYGGVGAGIAISSLAVYLIGVVFDGGGSSwree 176 Agrobacterium t...
Q92UK2        77 LTSSVLAYSIIRFLAGLASAFAMIFISGIV--LGQGLAARSEHVPSVHFGGVGFGIALSSIAVWVAPLAGVAGLSMsqad 154 Sinorhizobium m...
Q8Y185       110 VLQGQPAWLVLRFAAGVVSALVFVFTAGWC--LHRLTELGHAALGGIIFCGPGLGIAVPGLVASGMVALGWHASSA---- 183 Ralstonia solan...
Q88ED9        90 AANGFWGHLLLRFGTGVASAWVLVMITSLS--QQVATAHNRQRLGALVFAGPGLGIAVTGLLALVAHVLGLGSAAL---- 163 Pseudomonas put...
Q9I3T2        96 WAEGFWPHALLRFGLGVASAWVLIMVTALS--QRLAAESGRARLGALVFAGPGIGVMVTGLLAALGNALGQDSVFI---- 169 Pseudomonas aer...
Q9PGN0       104 FTSHFFLVMLIRFAAGVSSAAMMIFGSITI--MRH---TFNVRVIASLYAGVGIGILLGNEYVVIGLRHGLNASAL---- 174 Xylella fastidiosa
P39381       101 WLPPFILVLLIRVLAGVASAGMLIFGSTLI--MQH---TRHPFVLAALFSGVGIGIALGNEYVLAGLHFDLSSQTL---- 171 Escherichia col...
Q8ZJZ6       101 IFTQPAVVMLVRFLAGVASAGMMIFGSMIV--LHH---TRHPFVIAALFSGVGAGIALGNEYVIGGLHYALSAHSL---- 171 Salmonella ente...
Q89HQ1       124 APVSFSWFFAWRFLSGLTGGVIMVLAASVI--LPHISAARRGIVGGVIFAGVGLGVAASGTLVPLLLQQGLQQS------ 195 Bradyrhizobium ...
Q89X18       139 LTGNFVALSLARLVLGLGAAAGFVAGGALAasIAQSQPARANFLLSLFYAGPGIGILASGLIAPFTLQHFGPGSWWl--v 216 Bradyrhizobium ...
WP_010972214 177 WIAGAVFSFVAFLLVFRVLPa--gPPRHASSAAEP--PLAWTRPLFLTTLAYGLFGFGYVITATFIVAIARMA-AAGAFV 251 Agrobacterium t...
Q92UK2       155 WFVGALVALAGTVLVAALLP----ASRHAANGGRPevPLVRSRPLMAMTLTYGFFGFGYVITATFLVAMARDA-SGGHSV 229 Sinorhizobium m...
Q8Y185       184 WIAFGVLSAVLSAAVWPTVRperrPHAAASAPGISgaAPGLGLPTVIITLAYGLAGFGYIVTATFLPVIARRVlPAGSIW 263 Ralstonia solan...
Q88ED9       164 WLIYAVAALVMLLAVRPWLPr---ALQAAPTQSPVrqGPTRNVGTGRLGLVYGLYGMGYILPATFLSQMANQQ-FRGQWL 239 Pseudomonas put...
Q9I3T2       170 WKLFADLALVLILMLLPLLPr--pAARGAGHDAPA--TASENAGLGRLTWAYGLVGLGYIIPATFLSQMAAAR-FHGQWQ 244 Pseudomonas aer...
Q9PGN0       175 WYGASVLSFILLLLLFVLTPhvedKPREASASFPV---QQNSFLWWQLAALYGCAGFGYIIIATYLPLIAKT--FNVPFI 249 Xylella fastidiosa
P39381       172 WQGAGALSGMMLIALTLLMP----SKKHAITPMPLakTEQQIMSWWLLAILYGLAGFGYIIVATYLPLMAKD--AGSPLL 245 Escherichia col...
Q8ZJZ6       172 WLGAGALAGILLLIVAILIP----PRAHALPPAPLarIENQPMPWWQLALLYGFAGFGYIIVATYLPLMAKS--AGSPLL 245 Salmonella ente...
Q89HQ1       196 WYGLGALSALLTLASWWNWPa---ETKASAAPLHHakHHHASTAARALLVQYGLNAVALVPHMVFIVDFVARGlGQGIAA 272 Bradyrhizobium ...
Q89X18       217 WWAMTLLSAAMTVPLFLVRIesrvRFTEGSHASFA------ILPVLIYLAGYFLFGAGYIAYMTFMIAYVRDG-GGGAAA 289 Bradyrhizobium ...
WP_010972214 252 EFLAWFITGCAAAASL-FLWKPVLKSQRLKRAFVIVLAVEAVGVFASVMLPPVAGVLAGGLLLGLTFMVITAYGLQLGRE 330 Agrobacterium t...
Q92UK2       230 EFLAWLITGVSAALSV-YLWRFAVPRFGLAGVYAIGLLVEAVGLVLTVSLPSPYAPLVGGLMLGATFMMVTAYGLQIGRQ 308 Sinorhizobium m...
Q8Y185       264 PDLFWPIFGVGVALGA-LLSTRISLARDNRTLLAAAYAMQAVAVAASIVWPTVGGLALSSLLLGLPFTAITLFAMREARR 342 Ralstonia solan...
Q88ED9       240 ADLFWPAFGLAAALGVlLVSVRRDGR--TSTWLTATLWLQGLGVLACLMGGGI-GLALGVALCGGPFLACMQLVMQRSRE 316 Pseudomonas put...
Q9I3T2       245 ADLFWPCFGLASATGVvLISLRRQRPDGTRRWLVGALWLQALGVLACLL-PGIGGLALGVVLTGLPFLAGMQLVMQYARE 323 Pseudomonas aer...
Q9PGN0       250 AEHLWSLVGLTIIPSC-FAWLWAAQRWGTRRCLTINLLIQGCCVLLTLLSQAPFLLVISCIGFGATFMGTTSLVMPLTRQ 328 Xylella fastidiosa
P39381       246 TAHLWTLVGLSIVPGC-FGWLWAAKRWGALPCLTANLLVQAICVLLTLASDSPLLLIISSLGFGGTFMGTTSLVMTIARQ 324 Escherichia col...
Q8ZJZ6       246 TAHLWSLVGLAIIPGC-FGWLWAAKHWGVLPCLTANLLIQSACVLLSLASDSLLLLILSSIGFGATFMGTTSLVMPLARQ 324 Salmonella ente...
Q89HQ1       273 GSRYWVLYGLGAIVGP-LVTGHLGDRSGFGPALRAAFLIEAAAVLLPTVSTAPVSLIVSSVVVGGFTPGIVPLVLGRIHE 351 Bradyrhizobium ...
Q89X18       290 QAAFWSLIGLSAFVTP-WVWRGVLALDRGGLATAIILGTNALGAALPMLGHSPAWLAVSAVVFGVAFFAVVGSTTAFVRF 368 Bradyrhizobium ...
WP_010972214 331 FAGPSP---RRAFALMTAAFGTGQIVGPLAAGWIAEVTGSFTAPSI-LASAVLVVSILLML 387 Agrobacterium tumefaciens complex
Q92UK2       309 LAPESP---RRALAFMTAAFGIGQIVGPLVAGWLAERTGSYALPTL-VAAVVLMICGIVVL 365 Sinorhizobium meliloti
Q8Y185       343 LWPHAV---PRLMGLMTAVYGIGQIAGPPLANRLFAATGGFDASLA-AAAASLVLGMAMFL 399 Ralstonia solanacearum
Q88ED9       317 LAPQAT---QRNAGLLTACFALGQLSGPLLAALSSHYSGGLQPALM-LAAGGLVVAGGLVQ 373 Pseudomonas putida KT2440
Q9I3T2       324 LAPHTP---QRNAGQLTTGFALGQLLGPLLAALSTHFAGGLQPALA-LAGLGLVFAGLLLR 380 Pseudomonas aeruginosa
Q9PGN0       329 VSAPHR---INLLGLVTLTYGIGQILGPLLTSLLHSRLNTVTPAII-CGAVALFVAAGICQ 385 Xylella fastidiosa
P39381       325 LSVPGN---LNLLGFVTLIYGIGQILGPALTSMLSNGTSALASATL-CGAAALFIAALIST 381 Escherichia coli K-12
Q8ZJZ6       325 LSAPGN---INLLGLVTLTYGIGQILGPLAASLSGNGASAIINATL-CGAAALFFAALIsa 381 Salmonella enterica subsp. enteric...
Q89HQ1       352 LVPHATeqqRATWSHATTSFALFQAAAAYGFSWIYAQTGGDYLVLFgLGGGAAVLALAIDL 412 Bradyrhizobium japonicum
Q89X18       369 NYPPEVw--PTAIAAMTISFGVGQTLGPIVVGAITDALGSLSYALN-VSAALLALGAVAAL 426 Bradyrhizobium japonicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap