Conserved Protein Domain Family
LtrA

?
pfam06772: LtrA 
Bacterial low temperature requirement A protein (LtrA)
This family consists of several bacteria specific low temperature requirement A (LtrA) protein sequences which have been found to be essential for growth at low temperatures in Listeria monocytogenes.
Statistics
?
PSSM-Id: 399626
Aligned: 107 rows
Threshold Bit Score: 118.928
Threshold Setting Gi: 81451420
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCT62618             188 AIELFFDLLYVGIIHVNGEHVWAEPTGK----ELLRFAITFIMSWKIWSDITLILSWFETDDVFTRLEILFEIACLLGFS 263 Fusariu...
goetting:NONO_c03570  36 PLELLFDLTFVVAVGTAASYFAEMVAAGhagkAVLAFLLAMFAIVLAWINFSWFASAFATDDWLDRVLTMLQMIGVVIFA 115 Nocardi...
jgi:Gbro_0830         28 SLELFYDLVFVVAFSFTGTAAAHQIAEGhfrnALIGFLLCTFAAIWAWINFAWFASAFDTDDWFFRIVTLVQMIGVALIA 107 Gordoni...
jgi:Tpau_3662         31 TLELFFDLTFVVVFSLAGVQLADAVAEAhyltAFLGFGFCAFAAIWAWINFTWMASAFDTDDWLFRVVTMLQMLGICVLG 110 Tsukamu...
Q0S4F2                15 PLELLFDLTFVVAFGVAGDQFAHLVAEGhvaaGLAGFAFAMFSIIWAWINFSWFASAYDTDDWIYRVTTMIQMIGVIILA 94  Rhodoco...
jgi:Arth_3982         27 PLELFFDLTFVIAFGVAGSQFAHEIAEAhfgaGLLGFSFAMFAVIWAWINFTWFASAYDTDDWVFRVVTMIQILGVLILA 106 Arthrob...
WP_011730071          51 PLELLFDLTFVIAFGVAASQLAHLIAEGhvahGLTAFGFATFAIWWAWMNFTWFASAYDTDDWVYRAMTMLQMVGVIILA 130 Mycolic...
WP_019511610          15 PLELLFDLTFVIAFGVAASQFAHAFAAGhigaGLAGFAFAIFAVCWAWINFTWFASAYDTDDWVYRLTTMLQMVGVLILA 94  Mycobac...
WP_014212320          32 PLELLFDLTFVIAFGIAANEFAHMLAENhvgaGLLGFSLATFAVCWAWINFSWFASAYDTDDWVYRLMTMLQMVGVIIMA 111 Mycolic...
jgi:Mvan_4128         28 PLELLFDLTFVIAFGIAASEFAHLLAAGhvaaGLAGFFFAMFAVCWAWINFSWFASAYDTDDWPYRLTTMLQMVGVIVLA 107 Mycolic...
CCT62618             264 TNMTYAFYPGEhn---tyTMLVSFYVAARFRGVFHFLY----TGyllpmVRGVMFCQALNIIVPAALWIASihVEMp--S 334 Fusariu...
goetting:NONO_c03570 116 LGLPAMFHSVDqgdhlelRVMVIGYVVMRVAMVLQWTRaarqSPr----FRDVGAANVRWTVIAQIGWVIIgfVHLplgV 191 Nocardi...
jgi:Gbro_0830        108 LGVPEVFHSLDeah-lenRVMILGYIIMRVGMVAQWLRvavqSPr----YRRAALIYAGMTLLAQLGWVVIliAHMallP 182 Gordoni...
jgi:Tpau_3662        111 LGVAPFFQSVTagvtpdnGVIVLGYVIMRIALLAQWARvaiqSPq----YRQAAITYIVAIVIAQIGWIISalAPLtfgQ 186 Tsukamu...
Q0S4F2                95 LGMPPMFASIDrgveldnSVMVSGYIVMRIAMVFQWLRaakhDPe----HRSASLTYATMLVLAQIGWVASviAPLtveY 170 Rhodoco...
jgi:Arth_3982        107 MGIEPLFRSLVegdhvdnAVIVGGYVIMRLALVFQWLRaarqDPa----RRQTCLRYATYLGVVQLGWIAVliIQAdllA 182 Arthrob...
WP_011730071         131 LGLPATFASIDhgghvdnAVMVAGYVVMRIALVAQWLRaaaqDRq----HRTACLTYAAALVLAQLGWIAQifVQTtpmE 206 Mycolic...
WP_019511610          95 LGLPAMFASLEhgghvdnVVMVAGYVVMRVAMVAQWLRaarqDPp----RRRACLTYATIISVAQIGWIAVilLHTgllV 170 Mycobac...
WP_014212320         112 LGFPPMFASIEhgehvdsRVMVAGYVIMRIALVGQWLRaarqDPs----RRSACLTYALWVTIAQVGWIAGalVHKsipV 187 Mycolic...
jgi:Mvan_4128        108 LGLPQMYSSIEhgghvdnAVVVAGYVVMRVAMVAQWLRaarqDPl----RRRACLTYALWITIAQIGWVVAifVPTsvpV 183 Mycolic...
CCT62618             335 RLGLIWVAIALDMcgqsiltgvyqygrkaahdkrivkylsgifeFfPA-----------VNIEHRVERTNAFVSLVFGYS 403 Fusariu...
goetting:NONO_c03570 192 VIGGVLVLGVLELl------------------------------L-PVitqgs-aggtpWHPHHVAERYSLFAIITLGEG 239 Nocardi...
jgi:Gbro_0830        183 TVIAMIACVGVELv------------------------------G-PFlgetrtrggtpWHPHHIAERYSLLTIITLGEG 231 Gordoni...
jgi:Tpau_3662        187 LIVVGLVLYVVELg------------------------------G-PWiaerk--qrtpWNPHHIAERYGLLTIITLGEG 233 Tsukamu...
Q0S4F2               171 AFGLGAILILVELt------------------------------S-PViaery-kggtpWHAHHIVERHGLLVIITLGEG 218 Rhodoco...
jgi:Arth_3982        183 TILMTVPLYVLEMa------------------------------T-PYvaers--mrtpWHAHHIAERYGLLAIIALGEC 229 Arthrob...
WP_011730071         207 FFATGAVLVAVEIc------------------------------G-PLvaerr-mggtpWHAHHIAERYGLLAIIALGEG 254 Mycolic...
WP_019511610         171 TGLLVIALTLFEMa------------------------------G-PVvaerr-aggtpWHAHHIAERYGLMAIIALGEG 218 Mycobac...
WP_014212320         188 TFAMVVVLIAVETl------------------------------G-PIiaeyr-aggtpWHAHHIAERYGLLAIISLGEG 235 Mycolic...
jgi:Mvan_4128        184 TAAIVVSLVLVEVt------------------------------G-PVvaewr-qggtpWHAHHIVERYGLFTIIALGEG 231 Mycolic...
CCT62618             404 VMGpmf----------qshGGYTVDVFLgkaVLGLCQAFVFNWIYFDVdGSNINIHaIRrsvissSVWHYAHLPFIMGYI 473 Fusariu...
goetting:NONO_c03570 240 VVGtvassgdllggvdgthWSADAIAVV---VAGVGLTFGMWWVYFIT-PFGDILV-HRrn--rgYLFGYGHFPLYIGIA 312 Nocardi...
jgi:Gbro_0830        232 VVGtvtvlga---lievqgWSTDTVLLG---TSAMTATFAMWWVYFIV-PVGDALH-EHrh--ksFWWGYGHILIFMAAA 301 Gordoni...
jgi:Tpau_3662        234 VVGtvvamqa---lvkaqnWSFDVAVFG---IAALALNLCLWWIYFSI-PVAHALA-ANkn--kcFPWGYGHIVIFMAVA 303 Tsukamu...
Q0S4F2               219 VIGtvaslsa---vvehqgWTLDAILVA---VAGIGLTFGLWWVYYTL-PSAEVLA-VYrs--rsFVWGYSHIALFASLA 288 Rhodoco...
jgi:Arth_3982        230 LIGaietlra---ivanhgWSVDAALVG---FGGTALAFAMWWIYFIL-PAGRALH-LQrh--rsFFFGYGHIPIFAAIA 299 Arthrob...
WP_011730071         255 VVGtaaslta---avgeqgWSTDAVLLA---MAGTGLTFGLWWVYFLV-PAAELLH-VHrr--lsFRYGYLHIFVFGAIV 324 Mycolic...
WP_019511610         219 VVGtvatlta---vvsdhgWSTEAILVA---VAGIGLTFGMWWMYFMV-PAGELLH-VHre--tsFWFGYLPIVLYGAIV 288 Mycobac...
WP_014212320         236 VVGtvaslsa---vvsaqgWSFDAAFVV---VAGIGLTFGMWWSYFVV-PQAELLA-AHre--rsFWFGYLPIVMYGAIV 305 Mycolic...
jgi:Mvan_4128        232 VVGtvaslta---vvgaqgWSVEAVFVA---VAGTGLTFGMWWIYYVL-PQADILH-LRre--rsFWFGYVHIVVFASIV 301 Mycolic...
CCT62618             474 LASAGLSKLVwvadtpdanpehltehyieRSDPeMADGIRYFYCqGLAVALFFMGVISVThdhrhpatrrlsKKTRMANR 553 Fusariu...
goetting:NONO_c03570 313 GAGAGLHVAGlq---------------leHHTR-IGPVAVVATL-ALPVGLYLLMVYLLH------------TLLLSAPD 363 Nocardi...
jgi:Gbro_0830        302 GFGAGLHVAAly---------------ieHESH-VAGGAVVASV-AIPLGFYCLGIIAMY------------DYLL-PFD 351 Gordoni...
jgi:Tpau_3662        304 AVGAGLHVEAlg---------------vsREAH-VSNLVVASAV-VLPVGLAVLGIAVMD------------AYLT-GFD 353 Tsukamu...
Q0S4F2               289 AVGAGLHVAAyy---------------ieHASH-IGATATVLSV-AAPVAIFLAGVYALY------------TYLLRVPD 339 Rhodoco...
jgi:Arth_3982        300 ATGAGLHVAAyy---------------idDEAH-IGAALAVACI-AAPVAVFKLSLTWLY------------SVMI-CVD 349 Arthrob...
WP_011730071         325 ATGAGLHLAAyh---------------veGHSH-LDAVATVLAV-AVPVAVFLVGMFVIY------------ATLVGTVD 375 Mycolic...
WP_019511610         289 GTGAGLHLAAyy---------------leEHSE-LGSAACVATV-AVPVAVYIWLIYLLH------------ALMLRTTS 339 Mycobac...
WP_014212320         306 ATGAGLHVSAyy---------------ieHHSK-LSSTETVLAV-ALPVGLYIASIYALY------------FVIVRKVA 356 Mycolic...
jgi:Mvan_4128        302 GTGAGLHAAAyy---------------ieHHSA-LSSVATVLTV-VIPVGVYIVTVYVLY------------AVMARTVA 352 Mycolic...
CCT62618             554 LLVCLILFL--------LPLAKSLNSLNLISITLALSL 583 Fusarium fujikuroi IMI 58289
goetting:NONO_c03570 364 PFHILLLALtaivlavaMILAAVGVSIAICLIIVMISp 401 Nocardia nova SH22a
jgi:Gbro_0830        352 PLSLVLAVVvvvvlagaVWLCVAGVSVVVAVAVAalap 389 Gordonia bronchialis DSM 43247
jgi:Tpau_3662        354 GKRAVTIAVtllllaagLVAVHFG---ATPLAVVVWSA 388 Tsukamurella paurometabola DSM 20162
Q0S4F2               340 PFHILLLVLtaatialaLVLAAQGVSMAWCLIVVMLAP 377 Rhodococcus jostii RHA1
jgi:Arth_3982        350 RTVIAVAAGvlaalagsVGLAAAGVSVPVCLLVIVLAL 387 Arthrobacter sp. FB24
WP_011730071         376 RFYLVLLVVaaaplvasVGLAAAGIDMALCLLLVTAAp 413 Mycolicibacterium smegmatis
WP_019511610         340 RVHLVLSLLasavlagsVLLAASGVPIAVCLLVTTLAP 377 Mycobacteriaceae
WP_014212320         357 LFHVVLLVLsaavlstaVWLAASGFSMANCLLVVTLAP 394 Mycolicibacterium rhodesiae
jgi:Mvan_4128        353 LFHVVTVVLsaavlglaVVLAAGGISMANCLLVVTLAP 390 Mycolicibacterium vanbaalenii PYR-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap