Conserved Protein Domain Family
Ins_allergen_rp

?
pfam06757: Ins_allergen_rp 
Insect allergen related repeat, nitrile-specifier detoxification
This family exemplifies a case of novel gene evolution. The case in point is the arms-race between plants and their infective insective herbivores in the area of the glucosinolate-myrosinase system. Brassicas have developed the glucosinolate-myrosinase system as chemical defense mechanism against the insects, and consequently the insects have adapted to produce a detoxifying molecule, nitrile-specifier protein (NSP). NSP is present in the small white butterfly Pieris rapae. NSP is structurally different from and has no amino acid homology to any known detoxifying enzymes, and it appears to have arisen by a process of domain and gene duplication of a sequence of unknown function that is widespread in insect species and referred to as insect-allergen-repeat protein. Thus this family is found either as a single domain or as a multiple repeat-domain.
Statistics
?
PSSM-Id: 429103
Aligned: 71 rows
Threshold Bit Score: 113.833
Threshold Setting Gi: 122000602
Created: 27-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002004323         39 ELLQDLREFIDLIPSITVDEVVAEHMLTDSGFRKAIKFLRSSDFKHLQQRAESLPEIIEVINFVH--------------L 104 Drosophi...
EDS38789             24 SLQDDLNDLQQHVPMAQIQELFVRYLMADPEFRQTVQYFRGPEFATMWNRFLEVPKVRELFTYMTsaglmv--nealemF 101 southern...
XP_001960916         22 DLRSDLKDFVALLPRRRIGFIAARYYIFDPKFRQSVEYIRSNDFISTWQKVREAPDFVNIINYLSdygsgyditsivdsL 101 Drosophi...
WGS:AAQB:GK23051-PA  62 DLCEDFQNLRATIDRATLVTIIQTHYECDSKFRRAMSYYNTTRFHEVAQMLQQSTAYRSLLQELQddgvdt--sdleniV 139 Drosophi...
XP_002005535         40 SLCPNFQELSGVIEVNTLAELIQGHSQCDAKFRKAMSYYQTKRFQLVIQELQQSEAYVTLLRDLRsagvdt--sdidniM 117 Drosophi...
XP_002050837         74 SLCNSFQALRATIEKDTLVDLIQSHYQCNSKFRKALCYYNTTRFQLVAQELQQSEVYNTMLEELRnagvdt--tdieniV 151 Drosophi...
XP_001986209         47 TLCDNFQALRETIDKNTLMDLIQSHYQCDSKFRKAMCYYNTTHFQIVAQQLQQSDGYHLMLEELRsggvdt--sdieniV 124 Drosophi...
XP_002018153         57 RLCAAFQDVRGLIDHEALVALIDTHSQCDAKFRKAIRFFNTPGFEEVALLLQESEAYQTALQELQiagvnt--tdieliL 134 Drosophi...
WGS:AAPP:GF11843-PA 123 KLCPDFQHLRDMMDQEKLQQLIQVHYNCDGKFRKAMRYYNTTPFEQVTQQLSDTDAYQTILRELEnssvyt--vdvesvA 200 Drosophi...
XP_002040095         54 ALCANFQHIRDMINQEALLNLIEVHYNCDLKFRRAMRYYNTPGFERTTQQLTDTDAYKTVLKELQsesvdt--adietvA 131 Drosophi...
XP_002004323        105 NDTAirsrilinksveqqlrayayksygypsitesafneeenegdadenSLVVILVPlnIQQepkrstnLNSF----VSF 180 Drosophi...
EDS38789            102 AGFT---------------------------------------------GMEKPRTKfrRSPk------SGGF----RAF 126 southern...
XP_001960916        102 PTRLray---------------------------------------qlsRTVPVELM--L---------RRDL----TTF 127 Drosophi...
WGS:AAQB:GK23051-PA 140 DIIA---------------------------------------------CIILP------VAkadndcdCRAVr--gHSF 166 Drosophi...
XP_002005535        118 DIFE---------------------------------------------CLDQPWPTtqQPPysnktcdCKQLr--gRNF 150 Drosophi...
XP_002050837        152 DIFA---------------------------------------------CLLVP------APqpdkscdCKALr--gHTF 178 Drosophi...
XP_001986209        125 DIIS---------------------------------------------CVTVP------PPlpdkncdCKQLk--gHTF 151 Drosophi...
XP_002018153        135 DIFA---------------------------------------------CIALP------VPqaekscdCSKVkkknHSF 163 Drosophi...
WGS:AAPP:GF11843-PA 201 AIFY---------------------------------------------CIILP------VQqpdtdcdCKSIr--gHSF 227 Drosophi...
XP_002040095        132 DIFH---------------------------------------------CIILP------VRqpdrncdCKAVk--hHTF 158 Drosophi...
XP_002004323        181 AQELLTHLPRDRFVALINEKRKSGTVFPKFYEAIRSDAFKSLLDKTMKSQNVQSLIKTLASHDIDAESLK 250 Drosophila mojavensis
EDS38789            127 IAEVVELCSSSDLASAHEAKKSSSSQYREMVSKFEAPEFKRLLAEASDDPQVKPLQDELSSYGIDFDVLF 196 southern house mos...
XP_001960916        128 LQDSIQSLPRARIYSLMSQKVRQDGEFAKLYKALRDKEFKELVQRARHSGEIQAPLKKFKQNFINVDELI 197 Drosophila ananassae
WGS:AAQB:GK23051-PA 167 MSDILLAMPKQKVHDYLSLARSEKSNFALLANTLTSPEFQERLRANMVKRDMVRPLRILRRNGWDIPELL 236 Drosophila willistoni
XP_002005535        151 VGDLLAAMPNQEVHSYTAEARAKHNNFGLFADTISSPAFQSRLRTNMLKRDAMRPLRVLRRYGWNVPEML 220 Drosophila mojavensis
XP_002050837        179 VGDLLAAMPQQAVHDYTTSARKNQTNYARFVDTVSSSGFQSRMRANMMKRDVIRPLRTLRRNGWDMPELL 248 Drosophila virilis
XP_001986209        152 MGDLLAAMPHQAVHEYTAKSRSRKSNFALFVDIVNSPEFQSHMRTNMMKRDVVRPMRVLRRNGWDLPQLL 221 Drosophila grimshawi
XP_002018153        164 IADLLALMPKSDVHGYSVDAQSKNSNFALFSRTVTSTEFQDTLRANIKKHDVARALKILRRNGWDILELL 233 Drosophila persimilis
WGS:AAPP:GF11843-PA 228 VDDVLNLMPQIEVHNYIVASQANGTNFGNFTKAVTSKEFQATLKANINKKDVIKPLRTLRRKGWDIPELL 297 Drosophila ananassae
XP_002040095        159 VGDLLAIMPKQEVHNYVAQSQANHTNFGNFTRAVVSKQFQATLKANINKRDVVKPLRTLRKNGWDIPELL 228 Drosophila sechellia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap