Conserved Protein Domain Family
S19

?
pfam06756: S19 
Chorion protein S19 C-terminal
This family represents the C-terminal region of eukaryotic chorion protein S19. In Drosophilidae, the S19 gene is known to form part of an autosomal cluster that also contains s16, s15 and s18. Note that members of this family contain a conserved PVA motif, and many contain pfam03964.
Statistics
?
PSSM-Id: 369066
View PSSM: pfam06756
Aligned: 5 rows
Threshold Bit Score: 107.777
Threshold Setting Gi: 195173512
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002046772 118 GNHGGNYggHQRGYGrPRWSVQPAGATLLYPGQNSYRRYASPPEYTKVVLPVRAAPPVAKLYLPENNYGSHG 189 Drosophila virilis
XP_002029772  93 GYNGGNY--RRAGYG-PRWTVQPAGATLLYPGQNNYKAYVSPPEYSKVILPIRPAAPVAKLYVPENQYGNQY 161 Drosophila sechellia
EDV96233      50 GRIGGNYggR---YIrPRFTVQPAGATLLYPGQNSYRRISSPVEYSKVILPVRAAAPVAKLYIPQNNYGSQV 118 Drosophila grimshawi
XP_002027534  94 PQHGS-Yg-RRGGYG-PRWTVQPAGATLLYPGQNNYRAYVSPPEYSKVVLPVRPAEPVAKLFIPENHYGQQS 162 Drosophila persimilis
XP_002062306 115 GPHGG-YgqRHGGYGrPRWTVQPAGATLLYPGQNNYRAYVSPPEYSKVILPIRPAAPVAKLFVPENNYNNag 185 Drosophila willistoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap