Conserved Protein Domain Family
DiS_P_DiS

?
pfam06750: DiS_P_DiS 
Bacterial Peptidase A24 N-terminal domain
This family is found at the N-terminus of the pre-pilin peptidases (pfam01478). It's function has not been specifically determined; however some of the family have been characterized as bifunctional, and this domain may contain the N-methylation activity (EC:2.1.1.-). It consists of an intracellular region between a pair of transmembrane. This region contains an invariant proline and two almost fully conserved disulphide bridges - hence the name DiS-P-DiS. The cysteines have been shown to be essential to the overall function of the enzyme in, but their role was incorrectly ascribed.
Statistics
?
PSSM-Id: 399614
Aligned: 417 rows
Threshold Bit Score: 64.7583
Threshold Setting Gi: 504617925
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013434091          37 VLGLVIGSFLTVVVHRVPQmlehawqqelagylpqnaqhalsaesdghdavpnpapeqrpaplsqtdlprrY-NLW-VPR 114 Parabur...
WP_014643904          11 tTGLILGSFYHVVGIRLPV----------------------------------------------------RtPFL-TGR 37  Halobac...
jgi:Pjdr2_2102        11 ILGLIVGSFFNVVGLRIPL----------------------------------------------------KlSVV-SPP 37  Paeniba...
zhongguo:PM3016_6782  11 LLGITLGSFYNVVALRVPA----------------------------------------------------KeSIV-HPP 37  Paeniba...
sklacau:PSAB_22165    11 LLGLILGSFYNVVALRVPA----------------------------------------------------GeSLT-APP 37  Paeniba...
jgi:Bsel_1444         11 ITGLVMGSFYNVVGLRVPA----------------------------------------------------GeSFTgKAR 38  [Bacill...
Q65GL0                 8 tAGLVLGSFFNSAGRRIPE----------------------------------------------------KiSLI-APR 34  Bacillu...
P15378                 7 IFGLILGSFYYTAGCRIPL----------------------------------------------------HlSII-APR 33  Bacillu...
Q8CXM1                11 ILGAILGSFFMVVGLRLPK----------------------------------------------------QmPFV-NAR 37  Oceanob...
WP_015009744          11 ILGTVFGSFFNVVGLRGPK----------------------------------------------------GeRFT-NDR 37  Amphiba...
WP_013434091         115 SACTACGHTLRLHENIPLLSFITLRGRCSACSTRIRWRYPLIESACALFAALSLAAF 171 Paraburkholderia rhizoxinica
WP_014643904          38 SQCPHCQTKLQPIDLIPLFSYLLTKGACRHCCNHISLSYPLVEALTGVLFLFSYIVY 94  Halobacillus halophilus
jgi:Pjdr2_2102        38 SQCPKCGMRLKPRDLMPVASYLLSRGRCRQCGKRISPVYPLGELATGFLFAWIYLTF 94  Paenibacillus sp. JDR-2
zhongguo:PM3016_6782  38 SACPNCSTQLRPRDLVPVLSWLLSRGRCRHCGTPVSVLYPLGELATGGLLVGVYTLh 94  Paenibacillus mucilaginosus 3016
sklacau:PSAB_22165    38 SHCTSCGTRLRARDLIPVFSWLASGGKCRHCGTRVSPLYMLGELATGLLFLWSYLKF 94  Paenibacillus sabinae T27
jgi:Bsel_1444         39 SKCPSCGKTLGAPELIPVLSWFLLRGRCKGCGKRISPMYPLMELVTGVLFGLAFLHI 95  [Bacillus] selenitireducens MLS10
Q65GL0                35 SLCRVCKRQLGFSELIPVLSYLMQRGRCKGCQTPLSIVYPAVELSAAILFAFAGMHV 91  Bacillus licheniformis DSM 13 ...
P15378                34 SSCPFCRRTLTPAELIPILSFLFQKGKCKSCGHRISFMYPAAELVTACLFAAAGIRF 90  Bacillus subtilis subsp. subti...
Q8CXM1                38 SCCDHCQYQLRWFDNIPIVSYIYLRGKCRKCKTRIHPLHVVAEIITGILFTVSYYHI 94  Oceanobacillus iheyensis
WP_015009744          38 SYCPNCEKQLQWYELIPVVSYILLKGKCRSCQIKIRKLYPTIELLTGLFFAISYWRF 94  Amphibacillus xylanus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap