Conserved Protein Domain Family
Pescadillo_N

?
pfam06732: Pescadillo_N 
Pescadillo N-terminus
This family represents the N-terminal region of Pescadillo. Pescadillo protein localizes to distinct substructures of the interphase nucleus including nucleoli, the site of ribosome biogenesis. During mitosis pescadillo closely associates with the periphery of metaphase chromosomes and by late anaphase is associated with nucleolus-derived foci and prenucleolar bodies. Blastomeres in mouse embryos lacking pescadillo arrest at morula stages of development, the nucleoli fail to differentiate and accumulation of ribosomes is inhibited. It has been proposed that in mammalian cells pescadillo is essential for ribosome biogenesis and nucleologenesis and that disruption to its function results in cell cycle arrest. This family is often found in conjunction with a pfam00533 domain.
Statistics
?
PSSM-Id: 399601
View PSSM: pfam06732
Aligned: 36 rows
Threshold Bit Score: 322.261
Threshold Setting Gi: 74877612
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O97209        13 KKERFKKKFLTRMQATRLLQMESVQFRRLCILKGIYPRALNRsKQKQSGNE---KQYYLAREIKWLVRDQIAEKMMAYRA 89  Leishmania major
Q7R7N4        10 IKKKHQEKYLTKKKIQKKLFLNESEFRRLCIFKGIYPKDYKDiPLKFRNKFyknKVYYTRNDYKKLSNEKIIQDFRKIKT 89  Plasmodium yoel...
XP_004243564  11 KKEGNAARYITRSQAVKYLQVSLSLFRKLCILKGIFPREPKK-KVKGNH-----HTYYHTKDILFLKHEPLLEKFREMRA 84  tomato
XP_006833187  11 KREGNSAKYITRTKAIHYLQINLSSFRKLCILKGIFPREPKK-KLEGND-----KTYYHMKDIMFLAHEPLLEKFREIRA 84  Amborella trich...
EFA81738      10 NEKGENIRFITRNAAARKLQISLKLFRKLCIIKGIHPRDPKK-KLQGKH-----KTYYYMKDIRFLQHEPIIQTLRDRKT 83  Heterostelium a...
Q54HJ2        10 GEKGENLKFITRNEAVKKLQISLKIFRKLCILKGIHPRDPKK-KFKGKH-----KTYYYSKDIKYLQNEKVLEIIRARKV 83  Dictyostelium d...
EGC36815      10 GVKGENLKFMTRNEAVKKLQVSLKVFRKLCILKGIHPRDPKK-KLKGKN-----KTYYYAKDIKYLQNEKILETIRERKT 83  Dictyostelium p...
A0DEJ7         8 GKEGPVKEYVSRTKALKKLQVNLKDFRRLCILKGIYPREPPQ-KLRKQH-----KTYYHNKDIAFLKNESILDTFRQRQA 81  Paramecium tetr...
Q23RV6         8 NTRGEATKYISRAKAIKKLQVSLKDFRRLCILKGVYPREPPK-KLQKQN-----KTYYHLKDINYLMHEKILNKFRELKT 81  Tetrahymena the...
EGR30982       8 NTVGEATKYISRAKSIKKLQISLKDFRRLCILKGVYPREPPK-KLFKTG-----KTYYHKKDINYIMHEKILQKFREQKA 81  Ichthyophthiriu...
O97209        90 WEKKVKR-AEAMGRSEDLKVLQTSRvkPRHSLVATIKERYPYFIDAIRDVDDAMSMIHLYAFLsPeiKSdttieihHSLT 168 Leishmania major
Q7R7N4        90 SLKRYKKyKITLEDNERCKNIIKNF--PKYKLDHIIKERFPILVYAVEQLNDALTAIIAYSFL-PsnEN-------IGIK 159 Plasmodium yoel...
XP_004243564  85 YEKKIKK-AVSKKNRDLAERLLTRK--PSYTLDMLIRERYPKFIDALRDLDDCLSMVHLFAAL-PavER-------EKIP 153 tomato
XP_006833187  85 YDKKIKR-ALAKKNKDEVARLEKNR--PSYTLDHLVKERYPQFVDALRDLDDCLTMIHLFAAL-PavES-------ERIN 153 Amborella trich...
EFA81738      84 FAKKEKK-LRERKDWAALEQFIKNR--PSSSIDHIVRERYPTFTDALKDLDDCLTLIHLFASM-D--SS-------PKLR 150 Heterostelium a...
Q54HJ2        84 FKDREKK-LINKKQFGALKNLKENR--PMITLDHIIKERYPTFQDALKDLDDCLSLIHLFANM-D--AS-------AKVR 150 Dictyostelium d...
EGC36815      84 IKEKEIK-LIAKKEVALLKKLRENR--PMISLDHIVKERYPTFEDALKDLDDCLSLIFLFANM-D--AS-------PKIR 150 Dictyostelium p...
A0DEJ7        82 HLKKIRK-ALTRGDKLKAGRLRRNQ--PKDKLDHLVKERYPTFIDALNDLDDPLCLVSLFASF-PthKE-------LHIP 150 Paramecium tetr...
Q23RV6        82 HMKKVMK-LKAKGDKTRLRLLQKQK--PTYSLNHLVKERYPTFIDALRDLDDPLCLVNLFASF-PahKA-------LGVP 150 Tetrahymena the...
EGR30982      82 WAKKLQK-LKARKDEMRVKKLLKDK--PTYTLNHLIKERYPTFIDALRDLDDPLCLISLFSCF-AahKS-------LGVK 150 Ichthyophthiriu...
O97209       169 SGLSERAKEVCERWDRYVARARVLTKGFISIKGYYYEAIVKGERVRWLCPHEYAHRFPPGIQQYVMLSFLEFYLEMMKFV 248 Leishmania major
Q7R7N4       160 NNLINQSIILRNH-----------------VKGYYLQAEILQKKITWLIPHIFTPYFDKSIDFKIITNFIEYYVTLLRFI 222 Plasmodium yoel...
XP_004243564 154 VNRVHNCRRLGHEWQAYIARTHKLRKTFISVKGIYYQAEIDGQKITWLTPHALQQVLPDDVDYNIMLTFLEFYETLQAFV 233 tomato
XP_006833187 154 VNRIHNCRRLSHEWQAYISRTHSLRKTFISVKGIYYQAEVQGQKITWLTPHALQQVIPDDVDFNVMLTFLEFYETLLAFA 233 Amborella trich...
EFA81738     151 ENHIVTCADLCREFQHYVTVSKSLKKVFVSIKGIYYQAEIMGETITWLTPINYINKKEKKVDYGVMINFLEFYEVMLKFV 230 Heterostelium a...
Q54HJ2       151 ENQILACERLAREFQYYIIQSKSLRKVFVSVKGVYYQADVMGETITWITPLNYLSKKEKEVDYGVMISFLEFYQALMKFV 230 Dictyostelium d...
EGC36815     151 ENQIRACEKLAREFQYYVAKSNSLKKVFVSVKGIYYQAEIMGETITWITPLNYLSKKEKQVDYGVMISFIEFYQALMKFV 230 Dictyostelium p...
A0DEJ7       151 NTLIRGCQKLLSQFLLYVSANNCLRKVFLSIKGIYYQAVVQGATITWIMPYPIQASLPLDVDYKIMMTFLEFYQVLMKFV 230 Paramecium tetr...
Q23RV6       151 RDSITKCIKLMREFNLFVIKSKSLRKVFISIKGIYYQAEIEGQKITWIAPFQLPAELPAEVDYKVMLTFLEFYETLIKFV 230 Tetrahymena the...
EGR30982     151 RNIVEKCIRLQREFNLYIIKSRSLEKVFVSIKGIYYQAQIEGQKITWIQPFQLPAELPVEVDYKVMLTFLEFYEILVKFV 230 Ichthyophthiriu...
O97209       249 LFKLE-SDLARDEADRLAaeDEEGVTRANAEDFAngaa-lavLDVGANQAQ------AKA 300 Leishmania major
Q7R7N4       223 LYKLY-RLDGMSYPPK----EYKDLKNEKLNHLS--------FDKNYITKE------LSN 263 Plasmodium yoelii yoelii
XP_004243564 234 NFKLY-HSINVKYPPILD--PRLEALAADLYALSryfdnrasMAESSttsfsetdvskdq 290 tomato
XP_006833187 234 NFKLY-HSINVKYPPTLD--PRLEALAADLYALSr------yLAASSRTLL------LDN 278 Amborella trichopoda
EFA81738     231 NYKLY-TSLGLKYPPTID--KSRLNNGEHLSSI---------LTEKLNKTS------TTT 272 Heterostelium album PN500
Q54HJ2       231 NYRLF-TSIGLTYPPTID--DAKLRKCDSLINI---------FESKPQQQT------KTN 272 Dictyostelium discoideum
EGC36815     231 NYRLF-SSLDLEYPPKID--EIKLGKAEGLFNI---------FDSLKTKTA------INA 272 Dictyostelium purpureum
A0DEJ7       231 NFKLLgQDIEI---------TDFSEEVKKLKSVSqn----nqIEIDEAFKEdptiqqMDQ 277 Paramecium tetraurelia
Q23RV6       231 NFKLF-NSINVKYPLEINk-SIEDQSYFSYSSFV--------LKHKDSQQT------IEN 274 Tetrahymena thermophila SB210
EGR30982     231 NFKLF-SNLGIKYPITINq-SIEDQSYFSYSSFV--------LETKDSQQT------LEQ 274 Ichthyophthirius multifiliis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap